LXL04_032793 | RubberDandelionOmics

Gene overview

LXL04_032793

Reference: OH-1004 Chr: Chr07 Coordinates: 29378688-29384768 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3363 bp · LXL04_032793|LXL04_032793|OH1004|cDNA

TAACAGcaagaagatgaagaaatgcttGTTCCACATACAGAACTAGTGGAAGGTCCTCTTGCTTTGGATGGTACTCCACCTGTTGTAGGCCCTCAACCTATGGAAGTCATCGGTCCAGCAGAAGTTGTTAGCACTGCAGAGAATCAACCAGCTGATGAAACTCAGGCATCTAGGTTTACATGGGTAATTGATAATTTCTCACGTCAAAGTAACAAAAAGATTTATTCAGATACTTTCGTGGTTGGTGGATTCAAATGGCG...

CDS

Download CDS FASTA

3342 bp · LXL04_032793|LXL04_032793|OH1004|CDS

ATGCTTGTTCCACATACAGAACTAGTGGAAGGTCCTCTTGCTTTGGATGGTACTCCACCTGTTGTAGGCCCTCAACCTATGGAAGTCATCGGTCCAGCAGAAGTTGTTAGCACTGCAGAGAATCAACCAGCTGATGAAACTCAGGCATCTAGGTTTACATGGGTAATTGATAATTTCTCACGTCAAAGTAACAAAAAGATTTATTCAGATACTTTCGTGGTTGGTGGATTCAAATGGCGTGTGCTTATATTTCCAAAGGG...

Protein

Download Protein FASTA

1113 aa · LXL04_032793|LXL04_032793|OH1004|PROTEIN

MLVPHTELVEGPLALDGTPPVVGPQPMEVIGPAEVVSTAENQPADETQASRFTWVIDNFSRQSNKKIYSDTFVVGGFKWRVLIFPKGNNVDNLSMYLDVADSSTLPYGWSRYAQFSLAVVNQIHTKFTMRKDTQHQFHGRESDWGFTSFMPLVDLYDPSKGFLVNDTCIIEADVAVRKVIDYWSYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDMPTGSIPLALQSLFYKLQYNETSVATKEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032793`
TK1151 ID	TkA08G205040
OH-1004 ID	LXL04_032793
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 98.670 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032793

Location Chr07:29378688-29384768 (+)

Description Similar to UBP12: Ubiquitin carboxyl-terminal hydrolase 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06600`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release
`At3g11910`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032793 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0006283 transcription-coupled nucleotide-excision repair Biological Process

GO:0006307 DNA alkylation repair Biological Process

GO:0006508 proteolysis Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010507 negative regulation of autophagy Biological Process

GO:0010508 positive regulation of autophagy Biological Process

GO:0010803 regulation of tumor necrosis factor-mediated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0031647 regulation of protein stability Biological Process

KEGG gene cross-reference

ath:AT3G11910

ath:AT5G06600

hsa:7874

mmu:252870

spo:2541131

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.602

Rank 1 · LXL04_032793 · OH-1004

Nucleus0.414

Rank 2 · LXL04_032793 · OH-1004

Cell membrane0.092

Rank 3 · LXL04_032793 · OH-1004

Mitochondrion0.072

Rank 4 · LXL04_032793 · OH-1004

Endoplasmic reticulum0.065

Rank 5 · LXL04_032793 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22486.3MATH_251-174 aa

PF00917.33MATH56-176 aa

PF00443.36UCH194-515 aa

PF13423.13UCH_1194-469 aa

PF12436.15USP7_ICP0_bdg619-871 aa

PF14533.13USP7_C2881-1092 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032793	`PF22486.3`	MATH_2	51	174	1.5e-36	126.3
LXL04_032793	`PF00917.33`	MATH	56	176	8e-17	62.3
LXL04_032793	`PF00443.36`	UCH	194	515	4e-58	197.7
LXL04_032793	`PF13423.13`	UCH_1	194	469	2.8e-15	57.5
LXL04_032793	`PF12436.15`	USP7_ICP0_bdg	619	871	1.8e-78	264.0
LXL04_032793	`PF14533.13`	USP7_C2	881	1092	2.4e-59	201.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FPT1`	Arabidopsis thaliana	Ubiquitin C-terminal hydrolase 12	82.047%	Swiss-Prot	strong database homology
`Q84WU2`	Arabidopsis thaliana	Ubiquitin C-terminal hydrolase 13	80.054%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card