LXL04_032783 | RubberDandelionOmics

Gene overview

LXL04_032783

Reference: OH-1004 Chr: Chr07 Coordinates: 29258364-29261411 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3048 bp · LXL04_032783|LXL04_032783|OH1004|cDNA

ATGGCGGCCGTGCGGAAGCTCATTGTAGAAGTAGTTGACGCCCGAAATCTTCTCCCAAAAGACGGTCATGGCACATCAAGTCCCTACGTGATTCTTGATTTCTACGGCCAGCGGCGGAAGACCCGGGTGGTGGCTAGGGATTTGAACCCGGTTTGGAATGaggttttggaatttaatgtCGGAAAGCCGTCGGATGTGTTCGGTGATATGCTTGAAGTCGATGTTAATCACGATAAGAGTCTTGGGCCGACGACCAGAAC...

CDS

Download CDS FASTA

3048 bp · LXL04_032783|LXL04_032783|OH1004|CDS

ATGGCGGCCGTGCGGAAGCTCATTGTAGAAGTAGTTGACGCCCGAAATCTTCTCCCAAAAGACGGTCATGGCACATCAAGTCCCTACGTGATTCTTGATTTCTACGGCCAGCGGCGGAAGACCCGGGTGGTGGCTAGGGATTTGAACCCGGTTTGGAATGAGGTTTTGGAATTTAATGTCGGAAAGCCGTCGGATGTGTTCGGTGATATGCTTGAAGTCGATGTTAATCACGATAAGAGTCTTGGGCCGACGACCAGAAC...

Protein

Download Protein FASTA

1015 aa · LXL04_032783|LXL04_032783|OH1004|PROTEIN

MAAVRKLIVEVVDARNLLPKDGHGTSSPYVILDFYGQRRKTRVVARDLNPVWNEVLEFNVGKPSDVFGDMLEVDVNHDKSLGPTTRTNFLGRVRLNSQQFVKKGEEALIYYPLEKKHLFSWIQGEIGLKIYFVDDVAPPPAPPSPPSSEEVKAETKSSEVADAARAGDSEDPPATGKDKPNDEPPPPPPVPEAAPTEPVPPSEASNQDHDSDPDDSGDDHVQPSNPMKQERFDFDQLRTSRSMPDIKISGAIPIGPQPIP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032783`
TK1151 ID	TkA08G204600
OH-1004 ID	LXL04_032783
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032783

Location Chr07:29258364-29261411 (+)

Description Similar to QKY: Protein QUIRKY

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g17980`	May function as a signaling molecule by regulating the trafficking of other regulators.	No verified direct reference in this release
`At1g74720`	May be involved in Ca 2(+)-dependent signaling and membrane trafficking.	No verified direct reference in this release
`At4g11610`	May function as a signaling molecule by regulating the trafficking of other regulators.	No verified direct reference in this release
`At3g03680`	May function as a signaling molecule by regulating the trafficking of other regulators.	No verified direct reference in this release
`At5g48060`	May function as a signaling molecule by regulating the trafficking of other regulators.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032783 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009911 positive regulation of flower development Biological Process

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:0048467 gynoecium development Biological Process

GO:0048729 tissue morphogenesis Biological Process

GO:0051211 anisotropic cell growth Biological Process

GO:0099402 plant organ development Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G74720

ath:AT3G03680

ath:AT4G11610

ath:AT5G17980

ath:AT5G48060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.395

Rank 1 · LXL04_032783 · OH-1004

Endoplasmic reticulum0.325

Rank 2 · LXL04_032783 · OH-1004

Cytoplasm0.201

Rank 3 · LXL04_032783 · OH-1004

Golgi apparatus0.164

Rank 4 · LXL04_032783 · OH-1004

Nucleus0.104

Rank 5 · LXL04_032783 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168.37C26-109 aa

PF00168.37C2291-397 aa

PF00168.37C2447-544 aa

PF00168.37C2600-713 aa

PF08372.17PRT_C859-1015 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032783	`PF00168.37`	C2	6	109	1.1e-56	190.2
LXL04_032783	`PF00168.37`	C2	291	397	1.1e-56	190.2
LXL04_032783	`PF00168.37`	C2	447	544	1.1e-56	190.2
LXL04_032783	`PF00168.37`	C2	600	713	1.1e-56	190.2
LXL04_032783	`PF08372.17`	PRT_C	859	1015	2.9e-69	232.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJG3`	Arabidopsis thaliana	Multiple C2 domain and transmembrane region protein 16	62.301%	Swiss-Prot	strong database homology
`B8XCH5`	Arabidopsis thaliana	Protein QUIRKY	47.306%	Swiss-Prot	moderate database homology
`Q84TJ7`	Arabidopsis thaliana	Multiple C2 domain and transmembrane region protein 7	41.975%	Swiss-Prot	moderate database homology
`Q9SS68`	Arabidopsis thaliana	Multiple C2 domain and transmembrane region protein 14	43.305%	Swiss-Prot	moderate database homology
`Q9FI32`	Arabidopsis thaliana	Multiple C2 domain and transmembrane region protein 2	40.778%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card