LXL04_032777 | RubberDandelionOmics

Gene overview

LXL04_032777

Reference: OH-1004 Chr: Chr07 Coordinates: 29146730-29149784 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2298 bp · LXL04_032777|LXL04_032777|OH1004|cDNA

ATGGCATCTCATATTGTTGGATATCCACGTATGGGACCAAAACGAGAGTTGAAATTTGCGCTTGAATCGTTTTGGGATGGTAAGAGCAGTGCCGATGAATTGCAGAAAGTTGCTTCTGACCTTCGATCAAGCATCTGGAAACAGATGAAGGACGCTGGTATCAAATATATCCCTAGCAACACCTTCTCTTTCTACGATCAAGTCCTTGACACCACCGCCATGCTCGGTGCTGTTCCCGCAAGGTACAATTTCAAAGGCGG...

CDS

Download CDS FASTA

2298 bp · LXL04_032777|LXL04_032777|OH1004|CDS

ATGGCATCTCATATTGTTGGATATCCACGTATGGGACCAAAACGAGAGTTGAAATTTGCGCTTGAATCGTTTTGGGATGGTAAGAGCAGTGCCGATGAATTGCAGAAAGTTGCTTCTGACCTTCGATCAAGCATCTGGAAACAGATGAAGGACGCTGGTATCAAATATATCCCTAGCAACACCTTCTCTTTCTACGATCAAGTCCTTGACACCACCGCCATGCTCGGTGCTGTTCCCGCAAGGTACAATTTCAAAGGCGG...

Protein

Download Protein FASTA

765 aa · LXL04_032777|LXL04_032777|OH1004|PROTEIN

MASHIVGYPRMGPKRELKFALESFWDGKSSADELQKVASDLRSSIWKQMKDAGIKYIPSNTFSFYDQVLDTTAMLGAVPARYNFKGGEIGFDTYFAMARGNETVPAMEMTKWFDTNYHYIVPELGPDVAFSNASHKAVTEFKEAKALGVDTVPVLVGPVSYLLLSKPAKGVDKTFNLLSLLDKILPVYKQVITELKEAGATWIQLDEATLVKDLESQQLEAFSIAYSGLESACSGLNVLIATYFADITADAFKTLTSLPA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032777`
TK1151 ID	TkA08G203970
OH-1004 ID	LXL04_032777
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032777

Location Chr07:29146730-29149784 (+)

Description Similar to METE: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g17920`	Catalyzes the transfer of a methyl group from 5-methyltetrahydrofolate to homocysteine resulting in methionine formation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0624000`	Catalyzes the transfer of a methyl group from 5-methyltetrahydrofolate to homocysteine resulting in methionine formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032777 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process

GO:0009086 methionine biosynthetic process Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0032259 methylation Biological Process

GO:0071266 'de novo' L-methionine biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ag:CAA58474

ath:AT5G17920

dosa:Os12g0624000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.816

Rank 1 · LXL04_032777 · OH-1004

Nucleus0.252

Rank 2 · LXL04_032777 · OH-1004

Mitochondrion0.068

Rank 3 · LXL04_032777 · OH-1004

Endoplasmic reticulum0.067

Rank 4 · LXL04_032777 · OH-1004

Cell membrane0.059

Rank 5 · LXL04_032777 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08267.19Meth_synt_13-316 aa

PF01717.25Meth_synt_2432-755 aa

PF08267.19Meth_synt_1551-693 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032777	`PF08267.19`	Meth_synt_1	3	316	3.4e-127	425.0
LXL04_032777	`PF01717.25`	Meth_synt_2	432	755	7.6e-164	545.4
LXL04_032777	`PF08267.19`	Meth_synt_1	551	693	3.4e-127	425.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O50008`	Arabidopsis thaliana	5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 1	83.137%	Swiss-Prot	strong database homology
`Q2QLY4`	Oryza sativa subsp. japonica	5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2	83.029%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card