LXL04_032764 | RubberDandelionOmics

Gene overview

LXL04_032764

Reference: OH-1004 Chr: Chr07 Coordinates: 29058831-29060324 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

987 bp · LXL04_032764|LXL04_032764|OH1004|cDNA

ATGAGCAACAATGGGAAGAAGCCGAAAATGGTTGTGCAACTCGCCGATGCCGCCCCTTATGTCCTGCCTTACCTTCATCCGGCGGAGCTATCAGCCATCTCGTTAACCTGCAAAACACTACATCTCATTGCCAAATCAGTTACCGCCGCCCGTTCATCCGACGCCTGTAGGAACTCCGAGAAACTCCCCATTCCTTTCGTTAACACCAACGTGGACAATCATCCGTACGCCTACTTCATCTATACTCCGACTCAAGTCCT...

CDS

Download CDS FASTA

987 bp · LXL04_032764|LXL04_032764|OH1004|CDS

ATGAGCAACAATGGGAAGAAGCCGAAAATGGTTGTGCAACTCGCCGATGCCGCCCCTTATGTCCTGCCTTACCTTCATCCGGCGGAGCTATCAGCCATCTCGTTAACCTGCAAAACACTACATCTCATTGCCAAATCAGTTACCGCCGCCCGTTCATCCGACGCCTGTAGGAACTCCGAGAAACTCCCCATTCCTTTCGTTAACACCAACGTGGACAATCATCCGTACGCCTACTTCATCTATACTCCGACTCAAGTCCT...

Protein

Download Protein FASTA

328 aa · LXL04_032764|LXL04_032764|OH1004|PROTEIN

MSNNGKKPKMVVQLADAAPYVLPYLHPAELSAISLTCKTLHLIAKSVTAARSSDACRNSEKLPIPFVNTNVDNHPYAYFIYTPTQVLSFSNDLPRQPWGLCSIERPDIGLILPPTIEDGSRCECERCDNDLTACPCSRQNFSELRWECGSGCKCDFECPNRVSQRGISIRLKIVRSQRKGWGLHADQFIPSGEFICEYAGELLTTKEARNRQQTYDKNTSTNKQTSALLVVREHLPSGNACMRINIDATKIGNIARFVNH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032764`
TK1151 ID	TkA08G203520
OH-1004 ID	LXL04_032764
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032764

Location Chr07:29058831-29060324 (+)

Description Similar to SUVR3: Histone-lysine N-methyltransferase SUVR3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03750`	Histone methyltransferase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032764 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000729 DNA double-strand break processing Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006308 DNA catabolic process Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0015074 DNA integration Biological Process

GO:0031297 replication fork processing Biological Process

GO:0032259 methylation Biological Process

GO:0044774 mitotic DNA integrity checkpoint signaling Biological Process

GO:0045814 negative regulation of gene expression, epigenetic Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0090304 nucleic acid metabolic process Biological Process

GO:2000373 positive regulation of DNA topoisomerase (ATP-hydrolyzing) activity Biological Process

KEGG gene cross-reference

ath:AT3G03750

bta:511299

hsa:6419

mmu:74729

rno:500281

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.779

Rank 1 · LXL04_032764 · OH-1004

Cytoplasm0.238

Rank 2 · LXL04_032764 · OH-1004

Mitochondrion0.041

Rank 3 · LXL04_032764 · OH-1004

Cell membrane0.039

Rank 4 · LXL04_032764 · OH-1004

Plastid0.025

Rank 5 · LXL04_032764 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00856.34SET180-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032764	`PF00856.34`	SET	180	301	8.2e-21	75.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRV2`	Arabidopsis thaliana	Histone-lysine N-methyltransferase SUVR3	54.154%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card