LXL04_032728 | RubberDandelionOmics

Gene overview

LXL04_032728

Reference: OH-1004 Chr: Chr07 Coordinates: 28514859-28516490 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1632 bp · LXL04_032728|LXL04_032728|OH1004|cDNA

ATGGCAATACTCTCTTCTTTCAACTTCATTTTCCCTCTCCTGCTTCTCTTCCTCTCAACTCAATCCTCACCAACTTCCATTTCCATTACAGATAACTTCACGCGATGTCTTAACAACCACACAAACCCTTCTTTTCCAATCAGTGAACAACTCTACACTCCAGACAACTCCTCGTATCCCTCAGTTCTGCAAGCATACATCCGCAACCTTCGCTTCAACGAAACCACCACTCACAAACCCATACTAATCATCACCGCCAC...

CDS

Download CDS FASTA

1632 bp · LXL04_032728|LXL04_032728|OH1004|CDS

ATGGCAATACTCTCTTCTTTCAACTTCATTTTCCCTCTCCTGCTTCTCTTCCTCTCAACTCAATCCTCACCAACTTCCATTTCCATTACAGATAACTTCACGCGATGTCTTAACAACCACACAAACCCTTCTTTTCCAATCAGTGAACAACTCTACACTCCAGACAACTCCTCGTATCCCTCAGTTCTGCAAGCATACATCCGCAACCTTCGCTTCAACGAAACCACCACTCACAAACCCATACTAATCATCACCGCCAC...

Protein

Download Protein FASTA

543 aa · LXL04_032728|LXL04_032728|OH1004|PROTEIN

MAILSSFNFIFPLLLLFLSTQSSPTSISITDNFTRCLNNHTNPSFPISEQLYTPDNSSYPSVLQAYIRNLRFNETTTHKPILIITATHASHIQAAIVCARKHGLLMKTRSGGHDYEGLSYTSYTNQPFVIVDMFNLRSIHISMEHETAWVQSGATLGELYYQIAEKSNTHAFPSGVCPTIGVGGHFSGGGYGNMIRKYGLSIDNIVDAELIDANGKLLNRKSMGEDLFWAITGGGGVSFGVVLSYKIKLVRVPPVVTVFN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032728`
TK1151 ID	TkA08G201270
OH-1004 ID	LXL04_032728
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	83.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032728

Location Chr07:28514859-28516490 (-)

Description Similar to At1g30700: Berberine bridge enzyme-like 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30700`	Berberine bridge enzyme-like 8.	No verified direct reference in this release
`At1g30710`	Berberine bridge enzyme-like 9.	No verified direct reference in this release
`At1g34575`	Berberine bridge enzyme-like 14.	No verified direct reference in this release
`At4g20840`	Berberine bridge enzyme-like 21.	No verified direct reference in this release
`At5g44400`	Berberine bridge enzyme-like 26.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032728 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0016899 oxidoreductase activity, acting on the CH-OH group of donors, oxygen as acceptor Molecular Function

GO:0071949 FAD binding Molecular Function

KEGG gene cross-reference

ath:AT1G30700

ath:AT1G30710

ath:AT1G34575

ath:AT4G20840

ath:AT5G44400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.353

Rank 1 · LXL04_032728 · OH-1004

Endoplasmic reticulum0.189

Rank 2 · LXL04_032728 · OH-1004

Lysosome / Vacuole0.174

Rank 3 · LXL04_032728 · OH-1004

Cytoplasm0.137

Rank 4 · LXL04_032728 · OH-1004

Cell membrane0.134

Rank 5 · LXL04_032728 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01565.29FAD_binding_480-218 aa

PF08031.18BBE469-527 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032728	`PF01565.29`	FAD_binding_4	80	218	5.7e-24	85.1
LXL04_032728	`PF08031.18`	BBE	469	527	5.6e-18	65.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA85`	Arabidopsis thaliana	Berberine bridge enzyme-like 8	55.446%	Swiss-Prot	strong database homology
`Q9SA86`	Arabidopsis thaliana	Berberine bridge enzyme-like 9	51.756%	Swiss-Prot	strong database homology
`F4HV09`	Arabidopsis thaliana	Berberine bridge enzyme-like 14	52.762%	Swiss-Prot	strong database homology
`Q9SVG3`	Arabidopsis thaliana	Berberine bridge enzyme-like 21	50.992%	Swiss-Prot	strong database homology
`Q9FKU8`	Arabidopsis thaliana	Berberine bridge enzyme-like 26	46.429%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card