LXL04_032645 | RubberDandelionOmics

Gene overview

LXL04_032645

Reference: OH-1004 Chr: Chr07 Coordinates: 26838380-26839515 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

324 bp · LXL04_032645|LXL04_032645|OH1004|cDNA

ATGGGAGGAAAGTGTCCACACAGAAGGGTGAAGAAGAGACGATATTCGCACAAAACTTTTCGTCGCGATAAATTCCTCAAACCGGAGAGTGAGAAGGTTGCGTTGCCATTTGATGAAGATCTTCCTGGGATGGGGCAATACTACTGTTTACACTGCGATCGGTATTTTGCGAACGTGACAGTGAGAGATGATCATTTTAAGACGAAAAAACACAAGAAGCGTTTGAAGATAATGGCGGGTCCCGCACCACATACTCAGCT...

CDS

Download CDS FASTA

324 bp · LXL04_032645|LXL04_032645|OH1004|CDS

ATGGGAGGAAAGTGTCCACACAGAAGGGTGAAGAAGAGACGATATTCGCACAAAACTTTTCGTCGCGATAAATTCCTCAAACCGGAGAGTGAGAAGGTTGCGTTGCCATTTGATGAAGATCTTCCTGGGATGGGGCAATACTACTGTTTACACTGCGATCGGTATTTTGCGAACGTGACAGTGAGAGATGATCATTTTAAGACGAAAAAACACAAGAAGCGTTTGAAGATAATGGCGGGTCCCGCACCACATACTCAGCT...

Protein

Download Protein FASTA

107 aa · LXL04_032645|LXL04_032645|OH1004|PROTEIN

MGGKCPHRRVKKRRYSHKTFRRDKFLKPESEKVALPFDEDLPGMGQYYCLHCDRYFANVTVRDDHFKTKKHKKRLKIMAGPAPHTQLDADLAAGMGMPDNGPKLMST

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032645`
TK1151 ID	TkA08G192740
OH-1004 ID	LXL04_032645
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_032645`
Location	Chr07:26838380-26839515 (-)
Description	Similar to znf593: Zinc finger protein 593
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032645` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000055 ribosomal large subunit export from nucleus Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:1903026 negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003677 DNA binding Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	cel:CELE_Y56A3A.18 hsa:51042 mmu:68040 spo:2542462 xtr:549304 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.741

Rank 1 · LXL04_032645 · OH-1004

Cytoplasm0.295

Rank 2 · LXL04_032645 · OH-1004

Mitochondrion0.049

Rank 3 · LXL04_032645 · OH-1004

Endoplasmic reticulum0.020

Rank 4 · LXL04_032645 · OH-1004

Cell membrane0.018

Rank 5 · LXL04_032645 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12171.15zf-C2H2_jaz46-72 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032645	`PF12171.15`	zf-C2H2_jaz	46	72	9.5e-10	39.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card