LXL04_032601 | RubberDandelionOmics

Gene overview

LXL04_032601

Reference: OH-1004 Chr: Chr07 Coordinates: 26118046-26120981 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1774 bp · LXL04_032601|LXL04_032601|OH1004|cDNA

AAATAGAGACATAGCCTTCGCGTGAGCAGACGCAAGCTTTCATCCTCACAACATGTCACCCGTACATGCACTCTCTCCGGTCGCAGCCACCACCGTCCACCACAACCATCACCGTCTCTCTTCCATAGTACCCAAATCCCCTCTTCGAGTTACATACCTCCGGTCTTCAACAATCAAATCCTCAATTGAAAACAAACCCAAACCCAAACCCGCCTCCACCGCAAAAAACGGGTCATGGGTTAGTCCAGATTGGCTCACCT...

CDS

Download CDS FASTA

1722 bp · LXL04_032601|LXL04_032601|OH1004|CDS

ATGTCACCCGTACATGCACTCTCTCCGGTCGCAGCCACCACCGTCCACCACAACCATCACCGTCTCTCTTCCATAGTACCCAAATCCCCTCTTCGAGTTACATACCTCCGGTCTTCAACAATCAAATCCTCAATTGAAAACAAACCCAAACCCAAACCCGCCTCCACCGCAAAAAACGGGTCATGGGTTAGTCCAGATTGGCTCACCTCCTTAACTCGCTCTCTCTCCAACACTCAATCCGACGATTCAAACATACCGAT...

Protein

Download Protein FASTA

573 aa · LXL04_032601|LXL04_032601|OH1004|PROTEIN

MSPVHALSPVAATTVHHNHHRLSSIVPKSPLRVTYLRSSTIKSSIENKPKPKPASTAKNGSWVSPDWLTSLTRSLSNTQSDDSNIPIANAKLEDVSDLLGGALFLPLFKWMNEYGPIYRLAAGPRNFVIVSDPAIAKHVLRNYGTKYAKGLVAEVSEFLFGSGFAIAEDALWTARRRAVVPSLHKKYLSVIVDRVFCKCSERFVEKLKSYALNDTAVNMEQQFSQLTLDVIGLAVFNYNFDSLTADSPVIESVYTALKEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032601`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032601

Location Chr07:26118046-26120981 (+)

Description Similar to CYP97C1: Carotene epsilon-monooxygenase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53130`	Heme-containing cytochrome P450 involved in the biosynthesis of xanthophylls.	Functional analysis of beta- and epsilon-ring carotenoid hydroxylases in Arabidopsis.2003 · DOI: 10.1105/tpc.011403 Elucidation of the beta-carotene hydroxylation pathway in Arabidopsis thaliana.2006 · DOI: 10.1016/j.febslet.2006.07.055 The evolution and function of carotenoid hydroxylases in Arabidopsis.2009 · DOI: 10.1093/pcp/pcp005 Over-expression of Arabidopsis thaliana carotenoid hydroxylases individually and in combination with a beta-carotene ketolase provides insight into in vivo functions.2010 · DOI: 10.1016/j.phytochem.2009.10.011 A quadruple mutant of Arabidopsis reveals a β-carotene hydroxylation activity for LUT1/CYP97C1 and a regulatory role of xanthophylls on determination of the PSI/PSII ratio.2012 · DOI: 10.1186/1471-2229-12-50
`At1g31800`	Heme-containing cytochrome P450 involved in the biosynthesis of xanthophylls.	Defining the primary route for lutein synthesis in plants: the role of Arabidopsis carotenoid beta-ring hydroxylase CYP97A3.2006 · DOI: 10.1073/pnas.0511207103 Elucidation of the beta-carotene hydroxylation pathway in Arabidopsis thaliana.2006 · DOI: 10.1016/j.febslet.2006.07.055 The evolution and function of carotenoid hydroxylases in Arabidopsis.2009 · DOI: 10.1093/pcp/pcp005
`At4g15110`	Heme-containing cytochrome P450 probably involved in the biosynthesis of xanthophylls.	Over-expression of Arabidopsis thaliana carotenoid hydroxylases individually and in combination with a beta-carotene ketolase provides insight into in vivo functions.2010 · DOI: 10.1016/j.phytochem.2009.10.011

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032601 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0016123 xanthophyll biosynthetic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0010291 beta-carotene 3-hydroxylase activity Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0020037 heme binding Molecular Function

KEGG gene cross-reference

ath:AT1G31800

ath:AT3G53130

ath:AT4G15110

gmx:606504

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.982

Rank 1 · LXL04_032601 · OH-1004

Mitochondrion0.024

Rank 2 · LXL04_032601 · OH-1004

Cytoplasm0.015

Rank 3 · LXL04_032601 · OH-1004

Peroxisome0.014

Rank 4 · LXL04_032601 · OH-1004

Cell membrane0.011

Rank 5 · LXL04_032601 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p450107-530 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032601	`PF00067.28`	p450	107	530	2.9e-81	274.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6TBX7`	Arabidopsis thaliana	Carotene epsilon-monooxygenase, chloroplastic	81.693%	Swiss-Prot	strong database homology
`Q93VK5`	Arabidopsis thaliana	Protein LUTEIN DEFICIENT 5, chloroplastic	47.563%	Swiss-Prot	moderate database homology
`O23365`	Arabidopsis thaliana	Cytochrome P450 97B3, chloroplastic	42.857%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card