LXL04_032567 | RubberDandelionOmics

Gene overview

LXL04_032567

Reference: OH-1004 Chr: Chr07 Coordinates: 25624414-25627313 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1407 bp · LXL04_032567|LXL04_032567|OH1004|cDNA

ATGGCCACCATTAAGGAAGTAAAAGCACGACAAATCTTCGACAGCAGAGGCAATCCTACCGTCGAGGTGGACATTGGACTATCAAATGGTACATGGCACCGAGCTGCTGTTCCCAGTGGGGCATCCACTGGTGTCTACGAAGCACTAGAACTAAGAGATGGAGGCTCAGACTACCTAGGAAAGGGTGTTTCCAAGGCTGTTTCCAATGTGAACTCCATCATTGGCCCTGCTATTGTAGGCAAGGATCCAGCTGATCAAAC...

CDS

Download CDS FASTA

1407 bp · LXL04_032567|LXL04_032567|OH1004|CDS

ATGGCCACCATTAAGGAAGTAAAAGCACGACAAATCTTCGACAGCAGAGGCAATCCTACCGTCGAGGTGGACATTGGACTATCAAATGGTACATGGCACCGAGCTGCTGTTCCCAGTGGGGCATCCACTGGTGTCTACGAAGCACTAGAACTAAGAGATGGAGGCTCAGACTACCTAGGAAAGGGTGTTTCCAAGGCTGTTTCCAATGTGAACTCCATCATTGGCCCTGCTATTGTAGGCAAGGATCCAGCTGATCAAAC...

Protein

Download Protein FASTA

468 aa · LXL04_032567|LXL04_032567|OH1004|PROTEIN

MATIKEVKARQIFDSRGNPTVEVDIGLSNGTWHRAAVPSGASTGVYEALELRDGGSDYLGKGVSKAVSNVNSIIGPAIVGKDPADQTAIDNYMVQELDGTKNEWGWCKQKLGANAILAVSLAVCKAGASVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHNLKVQSFFINPIKYKHPNNNLSYLYPQSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032567`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032567

Location Chr07:25624414-25627313 (-)

Description Similar to PGH1: Enolase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36530`	Multifunctional enzyme that acts as an enolase involved in the metabolism and as a positive regulator of cold-responsive gene transcription.	LOS2, a genetic locus required for cold-responsive gene transcription encodes a bi-functional enolase.2002 · DOI: 10.1093/emboj/21.11.2692 Quantitative proteomics of the tonoplast reveals a role for glycolytic enzymes in salt tolerance.2009 · DOI: 10.1105/tpc.109.069211

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032567 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006096 glycolytic process Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0000015 phosphopyruvate hydratase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005740 mitochondrial envelope Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

KEGG gene cross-reference

ath:AT2G36530

rcu:8288376

sly:544068

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.692

Rank 1 · LXL04_032567 · OH-1004

Nucleus0.253

Rank 2 · LXL04_032567 · OH-1004

Mitochondrion0.147

Rank 3 · LXL04_032567 · OH-1004

Cell membrane0.106

Rank 4 · LXL04_032567 · OH-1004

Endoplasmic reticulum0.069

Rank 5 · LXL04_032567 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03952.22Enolase_N4-139 aa

PF00113.29Enolase_C148-198 aa

PF00113.29Enolase_C221-464 aa

PF13378.13MR_MLE_C316-426 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032567	`PF03952.22`	Enolase_N	4	139	5.8e-53	179.3
LXL04_032567	`PF00113.29`	Enolase_C	148	198	8.5e-151	502.0
LXL04_032567	`PF00113.29`	Enolase_C	221	464	8.5e-151	502.0
LXL04_032567	`PF13378.13`	MR_MLE_C	316	426	2.4e-06	28.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P25696`	Arabidopsis thaliana	Bifunctional enolase 2/transcriptional activator	84.402%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card