RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_032563
Reference: OH-1004 Chr: Chr07 Coordinates: 25596101-25597963 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1331 bp · LXL04_032563|LXL04_032563|OH1004|cDNA

ATGATAATCGGCGGTTCAAAAATGGACGCGCCGCCCAGTAACTGTAGTTGACTCCACCGCCTCTCCACCAGATTTTTTATGGCTGCTAAACGTTACCTATTTATACCTCATTTCCTCATCCATTCACCGACCATTTACAATTTTTACTCTCAAACACTGTCTCTTCGATGAATCCGCACTTTTCTTCATCAACTTCGGCAGGATCCGACCCGATACTCCATGGTTGGTCGTCTTCCCCGATCCCGTGTCAGCAGCCGCTT...

CDS

Download CDS FASTA

1164 bp · LXL04_032563|LXL04_032563|OH1004|CDS

ATGAATCCGCACTTTTCTTCATCAACTTCGGCAGGATCCGACCCGATACTCCATGGTTGGTCGTCTTCCCCGATCCCGTGTCAGCAGCCGCTTCCCCTGTCAGTAGCCTTTGGGGATGCTGCGGTGGTGACAATCGGAGAAGGGGATACTATTCCTCAGCCGCTGGACTGCTTACAAGGAACTCAAATCCCGCCATTTCTATCAAAAACTTTCGATTTGGTAAACGACCCGAGACTCGACCCGATTATCTCGTGGAGTGG...

Protein

Download Protein FASTA

387 aa · LXL04_032563|LXL04_032563|OH1004|PROTEIN

MNPHFSSSTSAGSDPILHGWSSSPIPCQQPLPLSVAFGDAAVVTIGEGDTIPQPLDCLQGTQIPPFLSKTFDLVNDPRLDPIISWSGSGQSFVVWDPMEFARIILPRNFKHNNFSSFVRQLNTYGFRKIDTDRWEFANERFLRGKRYLLKNIQRRKSNQSTSSNEEVNNSTEAEIERLHKEKTEMMKEIIDLQHEQRETHQYMDSINEKLKAAEHKQKQMISFMAKVIRNPTLVSSIREIKEPQLHIASPRSTRKFVKHQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_032563
TK1151 IDTkA08G188490
OH-1004 IDLXL04_032563
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_032563
LocationChr07:25596101-25597963 (+)
DescriptionSimilar to HSFA3: Heat stress transcription factor A-3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g03720 Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).
A cascade of transcription factor DREB2A and heat stress transcription factor HsfA3 regulates the heat stress response of Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2007.03334.x
Functional analysis of an Arabidopsis heat-shock transcription factor HsfA3 in the transcriptional cascade downstream of the DREB2A stress-regulatory system.2008 · DOI: 10.1016/j.bbrc.2008.01.134

Rice

Reference gene IDPossible functionPapers / DOI
Os02g0527300 Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). No verified direct reference in this release
Os07g0178600 Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). No verified direct reference in this release
Os10g0419300 Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE).
Isolation and characterization of a cDNA encoding two novel heat-shock factor OsHSF6 and OsHSF12 in Oryza sativa L.2005 · DOI: 10.5483/bmbrep.2005.38.5.602
Os03g0795900 Transcriptional activator expressed upon environmental stress that specifically binds DNA of heat shock promoter elements (HSE).
Expression of rice heat stress transcription factor OsHsfA2e enhances tolerance to environmental stresses in transgenic Arabidopsis.2008 · DOI: 10.1007/s00425-007-0670-4
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032563 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009408 response to heat Biological Process
GO:0034605 cellular response to heat Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function
GO:0003677 DNA binding Molecular Function
GO:0003700 DNA-binding transcription factor activity Molecular Function
GO:0042802 identical protein binding Molecular Function
KEGG gene cross-reference
ath:AT5G03720
dosa:Os02g0527300
dosa:Os03g0795900
dosa:Os07g0178600
dosa:Os10g0419300
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.965
Rank 1 · LXL04_032563 · OH-1004
Cytoplasm0.113
Rank 2 · LXL04_032563 · OH-1004
Cell membrane0.023
Rank 3 · LXL04_032563 · OH-1004
Endoplasmic reticulum0.013
Rank 4 · LXL04_032563 · OH-1004
Plastid0.012
Rank 5 · LXL04_032563 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00447.24HSF_DNA-bind66-155 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_032563PF00447.24HSF_DNA-bind661552.2e-29102.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8GYY1Arabidopsis thalianaHeat stress transcription factor A-346.471%Swiss-Protmoderate database homology
Q6H6Q7Oryza sativa subsp. japonicaHeat stress transcription factor A-351.389%Swiss-Protmoderate database homology
Q6VBB2Oryza sativa subsp. japonicaHeat stress transcription factor A-2b46.364%Swiss-Protmoderate database homology
Q338B0Oryza sativa subsp. japonicaHeat stress transcription factor A-2c40.493%Swiss-Protmoderate database homology
Q6F388Oryza sativa subsp. japonicaHeat stress transcription factor A-2e46.948%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser