LXL04_032493 | RubberDandelionOmics

Gene overview

LXL04_032493

Reference: OH-1004 Chr: Chr07 Coordinates: 24092412-24096079 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1056 bp · LXL04_032493|LXL04_032493|OH1004|cDNA

ATGACAACTGTAGCGGTGGttggtggcggtggtggtggtggtggtgatggtgtAGCTGTAGAgcaGTTTATAGGCCGTGCTAAGAACGGCCCAGTGCCATTTTATGCCCTAAAAAACAACTTTGTGTTAGACTGCACGGTGTGGGGGTCAAATGCCGGCAACATTGCTGATTTGGCAATGTTTGCCGGCGGCAAACACCGCCCCGCGGCTGTCCGCTGGATTCCATCGAATTTTTTGCAGATGGATGAACTTCCTTCGAC...

CDS

Download CDS FASTA

927 bp · LXL04_032493|LXL04_032493|OH1004|CDS

ATGACAACTGTAGCGGTGGTTGGTGGCGGTGGTGGTGGTGGTGGTGATGGTGTAGCTGTAGAGCAGTTTATAGGCCGTGCTAAGAACGGCCCAGTGCCATTTTATGCCCTAAAAAACAACTTTGTGTTAGACTGCACGGTGTGGGGGTCAAATGCCGGCAACATTGCTGATTTGGCAATGTTTGCCGGCGGCAAACACCGCCCCGCGGCTGTCCGCTGGATTCCATCGAATTTTTTGCAGATGGATGAACTTCCTTCGAC...

Protein

Download Protein FASTA

308 aa · LXL04_032493|LXL04_032493|OH1004|PROTEIN

MTTVAVVGGGGGGGGDGVAVEQFIGRAKNGPVPFYALKNNFVLDCTVWGSNAGNIADLAMFAGGKHRPAAVRWIPSNFLQMDELPSTFTEICRHIQAVNCVSRGGGNMSEAQRLTVNGSFNYSNGYTNGAISLSSPATRSAIDEFCNALNGKNPIHSILIANNGMVAVKFIRSLRTWSYETFASEKAIQLVAMATPEDIRINAEHIRIADQFVEVPGGTKNNNYANVQLIVEGSPTADIKFHEKMGSIDDEFGEATDFME...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032493`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032493

Location Chr07:24092412-24096079 (-)

Description Similar to ACC2: Acetyl-CoA carboxylase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g36180`	Multifunctional enzyme that catalyzes the carboxylation of acetyl-CoA, forming malonyl-CoA, which is used in the plastid for fatty acid synthesis and in the cytosol in various biosynthetic pathways including fatty acid elongation.	No verified direct reference in this release
`At1g36160`	Multifunctional enzyme that catalyzes the carboxylation of acetyl-CoA, forming malonyl-CoA, which is used in the plastid for fatty acid synthesis and in the cytosol in various biosynthetic pathways including fatty acid elongation.	Multifunctional acetyl-CoA carboxylase 1 is essential for very long chain fatty acid elongation and embryo development in Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.016010.x gurke and pasticcino3 mutants affected in embryo development are impaired in acetyl-CoA carboxylase.2004 · DOI: 10.1038/sj.embor.7400124 The GURKE gene encoding an acetyl-CoA carboxylase is required for partitioning the embryo apex into three subregions in Arabidopsis.2004 · DOI: 10.1093/pcp/pch148 Targeting of the Arabidopsis homomeric acetyl-coenzyme A carboxylase to plastids of rapeseeds.1997 · DOI: 10.1104/pp.113.1.75 The PASTICCINO genes of Arabidopsis thaliana are involved in the control of cell division and differentiation.1998 · DOI: 10.1242/dev.125.5.909

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0363300`	Multifunctional enzyme that catalyzes the carboxylation of acetyl-CoA, forming malonyl-CoA, which is used in the plastid for fatty acid synthesis and in the cytosol in various biosynthetic pathways including fatty acid elongation.	No verified direct reference in this release
`Os05g0295300`	Multifunctional enzyme that catalyzes the carboxylation of acetyl-CoA, forming malonyl-CoA, which is used in the plastid for fatty acid synthesis and in the cytosol in various biosynthetic pathways including fatty acid elongation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032493 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006085 acetyl-CoA biosynthetic process Biological Process

GO:0006606 protein import into nucleus Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009933 meristem structural organization Biological Process

GO:0010072 primary shoot apical meristem specification Biological Process

GO:0030497 fatty acid elongation Biological Process

GO:0042759 long-chain fatty acid biosynthetic process Biological Process

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

GO:2001295 malonyl-CoA biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G36160

ath:AT1G36180

dosa:Os05g0295300

dosa:Os10g0363300

osa:4348450

sce:YNR016C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.286

Rank 1 · LXL04_032493 · OH-1004

Cytoplasm0.236

Rank 2 · LXL04_032493 · OH-1004

Plastid0.221

Rank 3 · LXL04_032493 · OH-1004

Mitochondrion0.144

Rank 4 · LXL04_032493 · OH-1004

Cell membrane0.082

Rank 5 · LXL04_032493 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00289.29Biotin_carb_N155-232 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032493	`PF00289.29`	Biotin_carb_N	155	232	9.4e-13	49.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I1L3`	Arabidopsis thaliana	Acetyl-CoA carboxylase 2	69.767%	Swiss-Prot	weak database homology
`Q38970`	Arabidopsis thaliana	Acetyl-CoA carboxylase 1	75.893%	Swiss-Prot	weak database homology
`Q8S6N5`	Oryza sativa subsp. japonica	Acetyl-CoA carboxylase 1	69.231%	Swiss-Prot	weak database homology
`B9FK36`	Oryza sativa subsp. japonica	Acetyl-CoA carboxylase 2	69.492%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card