RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_032401
Reference: OH-1004 Chr: Chr07 Coordinates: 21793061-21796603 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1308 bp · LXL04_032401|LXL04_032401|OH1004|cDNA

ATGGATTCACAGCTCAAAGACCTGTCTTCAAAACCCCAATCTCCTACTTCTCAACCCAATCTCGATGACGCCTCCGATAATGACGATCACCCCCTCCTCAGccccaccaccaccactaccACCACCGATGACGACAAATCTGACTCCTCCACACCGCAATCCACCAGCAAAGAGCTGGAGATGAAATATGCAGCGTACGTCCGACACGATGGTTTAGCGACTAGAACAATCATGAACCGGTTTACTACTTCTCCAGTTCT...

CDS

Download CDS FASTA

1308 bp · LXL04_032401|LXL04_032401|OH1004|CDS

ATGGATTCACAGCTCAAAGACCTGTCTTCAAAACCCCAATCTCCTACTTCTCAACCCAATCTCGATGACGCCTCCGATAATGACGATCACCCCCTCCTCAGCCCCACCACCACCACTACCACCACCGATGACGACAAATCTGACTCCTCCACACCGCAATCCACCAGCAAAGAGCTGGAGATGAAATATGCAGCGTACGTCCGACACGATGGTTTAGCGACTAGAACAATCATGAACCGGTTTACTACTTCTCCAGTTCT...

Protein

Download Protein FASTA

435 aa · LXL04_032401|LXL04_032401|OH1004|PROTEIN

MDSQLKDLSSKPQSPTSQPNLDDASDNDDHPLLSPTTTTTTTDDDKSDSSTPQSTSKELEMKYAAYVRHDGLATRTIMNRFTTSPVLMIVSDLDHTMVCELPSQKALLQLDIIRSGAVKWTEIEKLGGKLSSVSSVAEVQLSQYIPTRSTLRLLQQIKFHLFPISGVLGVPNNESRDFIKNVASDKRKPMKLAAEHKIIHLGRFILYILSSATTPVLSTVGPLTEQARSLANITLKIALTAVTNLTSDHNPLLNVNNATG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_032401
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_032401
LocationChr07:21793061-21796603 (-)
DescriptionSimilar to SUD1: Probable E3 ubiquitin ligase SUD1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g34100 Probable E3 ubiquitin ligase acting as a positive post-transcriptional regulator of 3-hydroxy-3-methylglutaryl-coenzyme A reductase activity.
Arabidopsis ECERIFERUM9 involvement in cuticle formation and maintenance of plant water status.2012 · DOI: 10.1104/pp.112.198697
The SUD1 gene encodes a putative E3 ubiquitin ligase and is a positive regulator of 3-hydroxy-3-methylglutaryl coenzyme a reductase activity in Arabidopsis.2013 · DOI: 10.1105/tpc.112.108696

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032401 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0008299 isoprenoid biosynthetic process Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0010025 wax biosynthetic process Biological Process
GO:0010143 cutin biosynthetic process Biological Process
GO:0010345 suberin biosynthetic process Biological Process
GO:0010498 proteasomal protein catabolic process Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0036503 ERAD pathway Biological Process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process
GO:0045541 negative regulation of cholesterol biosynthetic process Biological Process
GO:0070936 protein K48-linked ubiquitination Biological Process
GO:0180027 inner nuclear membrane-associated protein degradation pathway Biological Process
KEGG gene cross-reference
ath:AT4G34100
hsa:10299
mmu:223455
spo:2539855
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.373
Rank 1 · LXL04_032401 · OH-1004
Nucleus0.214
Rank 2 · LXL04_032401 · OH-1004
Mitochondrion0.153
Rank 3 · LXL04_032401 · OH-1004
Cytoplasm0.142
Rank 4 · LXL04_032401 · OH-1004
Golgi apparatus0.117
Rank 5 · LXL04_032401 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4JKK0Arabidopsis thalianaProbable E3 ubiquitin ligase SUD162.083%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser