LXL04_032373 | RubberDandelionOmics

Gene overview

LXL04_032373

Reference: OH-1004 Chr: Chr07 Coordinates: 21488346-21489260 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

663 bp · LXL04_032373|LXL04_032373|OH1004|cDNA

ATGACGATTCTATACACGCTGGTGGCGAGAGGATCGGTGGTATTGGCTGAATTCAATAGCTCGCAGACGAACGCGAGCACGATTGCGAGGCAGATTCTCGAGAAAATCCCGGGAGATCATGATATCAATGTCTCGTATTCGCAGGATCGGTATATTTTTCATGTTAAGCGTACCGATGGGCTCACGGTTCTCTGTATGACCGACGACGTCGCCGGAAGAAGGGTTCCATTTACATTGCTTGAAGACATTCATCAAAGATT...

CDS

Download CDS FASTA

663 bp · LXL04_032373|LXL04_032373|OH1004|CDS

ATGACGATTCTATACACGCTGGTGGCGAGAGGATCGGTGGTATTGGCTGAATTCAATAGCTCGCAGACGAACGCGAGCACGATTGCGAGGCAGATTCTCGAGAAAATCCCGGGAGATCATGATATCAATGTCTCGTATTCGCAGGATCGGTATATTTTTCATGTTAAGCGTACCGATGGGCTCACGGTTCTCTGTATGACCGACGACGTCGCCGGAAGAAGGGTTCCATTTACATTGCTTGAAGACATTCATCAAAGATT...

Protein

Download Protein FASTA

220 aa · LXL04_032373|LXL04_032373|OH1004|PROTEIN

MTILYTLVARGSVVLAEFNSSQTNASTIARQILEKIPGDHDINVSYSQDRYIFHVKRTDGLTVLCMTDDVAGRRVPFTLLEDIHQRFVRTYGRAVLSAQAYGMNDEFSRVLNTQMEYYSNDPNADRINRIKGEMSQVRTVMIQNIDKVLERGDRLELLVDRTTTMQSNTFRFKKQSRKFRNSIWWRNVKLMFALIFLLLVLVYVMVAFACHGLTLPTCLR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032373`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032373

Location Chr07:21488346-21489260 (+)

Description Similar to VAMP713: Vesicle-associated membrane protein 713

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11150`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release
`At4g32150`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release
`At2g25340`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release
`At5g22360`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032373 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006906 vesicle fusion Biological Process

GO:0008333 endosome to lysosome transport Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010118 stomatal movement Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0061025 membrane fusion Biological Process

GO:0098876 vesicle-mediated transport to the plasma membrane Biological Process

GO:1901703 protein localization involved in auxin polar transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

KEGG gene cross-reference

ath:AT2G25340

ath:AT4G32150

ath:AT5G11150

ath:AT5G22360

ddi:DDB_G0277173

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.331

Rank 1 · LXL04_032373 · OH-1004

Golgi apparatus0.321

Rank 2 · LXL04_032373 · OH-1004

Lysosome / Vacuole0.313

Rank 3 · LXL04_032373 · OH-1004

Cell membrane0.170

Rank 4 · LXL04_032373 · OH-1004

Endoplasmic reticulum0.163

Rank 5 · LXL04_032373 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13774.14Longin15-111 aa

PF00957.28Synaptobrevin126-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032373	`PF13774.14`	Longin	15	111	6.4e-25	87.9
LXL04_032373	`PF00957.28`	Synaptobrevin	126	206	8.7e-28	96.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFP1`	Arabidopsis thaliana	Vesicle-associated membrane protein 713	69.683%	Swiss-Prot	strong database homology
`O49377`	Arabidopsis thaliana	Vesicle-associated membrane protein 711	73.973%	Swiss-Prot	strong database homology
`Q9SIQ9`	Arabidopsis thaliana	Vesicle-associated membrane protein 712	73.973%	Swiss-Prot	strong database homology
`Q9FMR5`	Arabidopsis thaliana	Vesicle-associated membrane protein 714	52.968%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card