LXL04_032355 | RubberDandelionOmics

Gene overview

LXL04_032355

Reference: OH-1004 Chr: Chr07 Coordinates: 21251197-21255814 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3246 bp · LXL04_032355|LXL04_032355|OH1004|cDNA

ATGGAGGCAAATGCTGGATTGGTAGCCGGATCTCATAAGAGGAACGAGTTGGTGAGGATAAGGCATGATTCCGATGGAGGGCCGAAGCCTTTAAAGAATATGAACGGGCAAATATGCCAAATTTGTGGCGACACCGTCGGCCTCACTGAAAACGGCGACGTTTTTGTTGCTTGCAACGAGTGCGCTTTTCCCGTCTGTAGGCCATGTTACGAGTACGAAAGAAGAGACGGAAATCAAGCATGCCCTCAATGCAAAACTCG...

CDS

Download CDS FASTA

3246 bp · LXL04_032355|LXL04_032355|OH1004|CDS

ATGGAGGCAAATGCTGGATTGGTAGCCGGATCTCATAAGAGGAACGAGTTGGTGAGGATAAGGCATGATTCCGATGGAGGGCCGAAGCCTTTAAAGAATATGAACGGGCAAATATGCCAAATTTGTGGCGACACCGTCGGCCTCACTGAAAACGGCGACGTTTTTGTTGCTTGCAACGAGTGCGCTTTTCCCGTCTGTAGGCCATGTTACGAGTACGAAAGAAGAGACGGAAATCAAGCATGCCCTCAATGCAAAACTCG...

Protein

Download Protein FASTA

1081 aa · LXL04_032355|LXL04_032355|OH1004|PROTEIN

MEANAGLVAGSHKRNELVRIRHDSDGGPKPLKNMNGQICQICGDTVGLTENGDVFVACNECAFPVCRPCYEYERRDGNQACPQCKTRYKRLKGSPRVDGDDDEDDVDDLENEFDYAQGNRKQWQGEDPDLSSSSRHESHRPVPLLTNGQQVSGEIPSATPDNLSVRSTSGPLGPGDKHAHYRDPRQPVPVRIVDPSKDLNSYGLGNVDWKERVEGWKLKQDKNIMQMANRYSGEGRGGEIEGTGSNGEELQIVDDPRQSM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032355`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032355

Location Chr07:21251197-21255814 (+)

Description Similar to CESA1: Cellulose synthase A catalytic subunit 1 [UDP-forming]

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32410`	Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	Fractionation of carbohydrates in Arabidopsis root cell walls shows that three radial swelling loci are specifically involved in cellulose production.2000 · DOI: 10.1007/s004250000301 PROCUSTE1 encodes a cellulose synthase required for normal cell elongation specifically in roots and dark-grown hypocotyls of Arabidopsis.2000 · DOI: 10.1105/tpc.12.12.2409 Morphology of rsw1, a cellulose-deficient mutant of Arabidopsis thaliana.2001 · DOI: 10.1007/bf01280308 Wall architecture in the cellulose-deficient rsw1 mutant of Arabidopsis thaliana: microfibrils but not microtubules lose their transverse alignment before microfibrils become unrecognizable in the mitotic and elongation zones of roots.2001 · DOI: 10.1007/bf01280312 Alpha-glucosidase I is required for cellulose biosynthesis and morphogenesis in Arabidopsis.2002 · DOI: 10.1083/jcb.200111093 Functional analysis of the cellulose synthase genes CesA1, CesA2, and CesA3 in Arabidopsis.2002 · DOI: 10.1104/pp.010931 Genetic complexity of cellulose synthase a gene function in Arabidopsis embryogenesis.2002 · DOI: 10.1104/pp.102.010603 Genetic evidence for three unique components in primary cell-wall cellulose synthase complexes in Arabidopsis.2007 · DOI: 10.1073/pnas.0706592104 Organization of cellulose synthase complexes involved in primary cell wall synthesis in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0706569104 Molecular analysis of cellulose biosynthesis in Arabidopsis.1998 · DOI: 10.1126/science.279.5351.717
`At2g25540`	Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	No verified direct reference in this release
`At5g05170`	Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	The Arabidopsis mutant cev1 has constitutively active jasmonate and ethylene signal pathways and enhanced resistance to pathogens.2001 · DOI: 10.1105/tpc.13.5.1025 Functional analysis of the cellulose synthase genes CesA1, CesA2, and CesA3 in Arabidopsis.2002 · DOI: 10.1104/pp.010931 The Arabidopsis mutant cev1 links cell wall signaling to jasmonate and ethylene responses.2002 · DOI: 10.1105/tpc.002022 Reduced cellulose synthesis invokes lignification and defense responses in Arabidopsis thaliana.2003 · DOI: 10.1046/j.1365-313x.2003.01729.x Genetic evidence for three unique components in primary cell-wall cellulose synthase complexes in Arabidopsis.2007 · DOI: 10.1073/pnas.0706592104 Organization of cellulose synthase complexes involved in primary cell wall synthesis in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0706569104

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0176100`	Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	No verified direct reference in this release
`UniProt: A2Y0X2`	Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032355 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT4G32410

ath:AT5G05170

dosa:Os05g0176100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.527

Rank 1 · LXL04_032355 · OH-1004

Endoplasmic reticulum0.209

Rank 2 · LXL04_032355 · OH-1004

Golgi apparatus0.163

Rank 3 · LXL04_032355 · OH-1004

Cytoplasm0.135

Rank 4 · LXL04_032355 · OH-1004

Lysosome / Vacuole0.101

Rank 5 · LXL04_032355 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14569.13zf-UDP29-106 aa

PF03552.21Cellulose_synt354-1068 aa

PF13632.13Glyco_trans_2_3769-876 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032355	`PF14569.13`	zf-UDP	29	106	1.2e-44	151.0
LXL04_032355	`PF03552.21`	Cellulose_synt	354	1068		1362.4
LXL04_032355	`PF13632.13`	Glyco_trans_2_3	769	876	1.7e-07	31.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48946`	Arabidopsis thaliana	Cellulose synthase A catalytic subunit 1 [UDP-forming]	84.502%	Swiss-Prot	strong database homology
`Q9SKJ5`	Arabidopsis thaliana	Probable cellulose synthase A catalytic subunit 10 [UDP-forming]	79.190%	Swiss-Prot	strong database homology
`Q941L0`	Arabidopsis thaliana	Cellulose synthase A catalytic subunit 3 [UDP-forming]	69.888%	Swiss-Prot	strong database homology
`Q6AT26`	Oryza sativa subsp. japonica	Probable cellulose synthase A catalytic subunit 1 [UDP-forming]	82.018%	Swiss-Prot	strong database homology
`A2Y0X2`	Oryza sativa subsp. indica	Probable cellulose synthase A catalytic subunit 1 [UDP-forming]	82.018%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card