LXL04_032341 | RubberDandelionOmics

Gene overview

LXL04_032341

Reference: OH-1004 Chr: Chr07 Coordinates: 21007723-21010499 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1194 bp · LXL04_032341|LXL04_032341|OH1004|cDNA

ATGGCTCTCAGCTTTTCTTGCCACGCCGCTGCTCTCAACACCCACCTCCACTGTAAATTGGATGCTACTCTGAACAAATCCCTTGAGAAAGTTAGGGATTTAGTCATAAAAAGGAAGGTTCCCTCGATCACAACTTTCCCACAAAAGTCTCTCGAGAAAGGCAATTGGGTCAAGCTAATTTGTGGTGCTAGCTTTGAGGATGTGGTAGATATTAGGAACCTTTCTCTTGTTTACACTTTGGCTGGAGCTGACTGTATTGA...

CDS

Download CDS FASTA

1194 bp · LXL04_032341|LXL04_032341|OH1004|CDS

ATGGCTCTCAGCTTTTCTTGCCACGCCGCTGCTCTCAACACCCACCTCCACTGTAAATTGGATGCTACTCTGAACAAATCCCTTGAGAAAGTTAGGGATTTAGTCATAAAAAGGAAGGTTCCCTCGATCACAACTTTCCCACAAAAGTCTCTCGAGAAAGGCAATTGGGTCAAGCTAATTTGTGGTGCTAGCTTTGAGGATGTGGTAGATATTAGGAACCTTTCTCTTGTTTACACTTTGGCTGGAGCTGACTGTATTGA...

Protein

Download Protein FASTA

397 aa · LXL04_032341|LXL04_032341|OH1004|PROTEIN

MALSFSCHAAALNTHLHCKLDATLNKSLEKVRDLVIKRKVPSITTFPQKSLEKGNWVKLICGASFEDVVDIRNLSLVYTLAGADCIDCAADEAVVNAVNEGINTAMTILPLRRPWVMISVNDDEDLHFRKAEFDPDDCPKDCTRPCEKICPANAIFKAGVITERCYGCGRCFPVCPYDKIKSISYVRDASETSKLIERDDVDAIEIHTNGRQTDSFEELWNGLRDSVNHLRLVAVSLPYVGDSTVSTMNKMYSILERDLC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032341`
TK1151 ID	TkA08G168420
OH-1004 ID	LXL04_032341
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.900
Protein coverage (%)	TK1151 88.603 / OH-1004 60.705 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_032341`
Location	Chr07:21007723-21010499 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032341` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0007623 circadian rhythm Biological Process GO:0051776 detection of redox state Biological Process GO:0046872 metal ion binding Molecular Function GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function
KEGG gene cross-reference	syf:Synpcc7942_0624 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.430

Rank 1 · LXL04_032341 · OH-1004

Mitochondrion0.266

Rank 2 · LXL04_032341 · OH-1004

Cytoplasm0.220

Rank 3 · LXL04_032341 · OH-1004

Nucleus0.149

Rank 4 · LXL04_032341 · OH-1004

Peroxisome0.043

Rank 5 · LXL04_032341 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25160.2LdpA_Fe-S-bd138-185 aa

PF12617.14LdpA_C195-389 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032341	`PF25160.2`	LdpA_Fe-S-bd	138	185	2.2e-23	82.5
LXL04_032341	`PF12617.14`	LdpA_C	195	389	7.7e-61	205.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card