LXL04_032290 | RubberDandelionOmics

Gene overview

LXL04_032290

Reference: OH-1004 Chr: Chr07 Coordinates: 19990085-19998463 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2589 bp · LXL04_032290|LXL04_032290|OH1004|cDNA

ATGAAGTATTACAAAAGTATTTATACAAACAAGCTAAGTACGGAACTAGGTTCAGTTCTAGGTCTCGAGGTTGACACCACAACAAGATCATATTTTACGCAACTCATAACACCAGAAGATGAAAAAAACGGCGATCAAGAAACCAAAAAAGATGGATTCTTAATGAAAGGCAACACCTACACTTTCCAAATCTCACAGGTTGAAGGAGGATCCAATATTCATGTTAAAGTTAGATTTTCTCAAAAACTGTTGTATCAAGA...

CDS

Download CDS FASTA

2589 bp · LXL04_032290|LXL04_032290|OH1004|CDS

ATGAAGTATTACAAAAGTATTTATACAAACAAGCTAAGTACGGAACTAGGTTCAGTTCTAGGTCTCGAGGTTGACACCACAACAAGATCATATTTTACGCAACTCATAACACCAGAAGATGAAAAAAACGGCGATCAAGAAACCAAAAAAGATGGATTCTTAATGAAAGGCAACACCTACACTTTCCAAATCTCACAGGTTGAAGGAGGATCCAATATTCATGTTAAAGTTAGATTTTCTCAAAAACTGTTGTATCAAGA...

Protein

Download Protein FASTA

862 aa · LXL04_032290|LXL04_032290|OH1004|PROTEIN

MKYYKSIYTNKLSTELGSVLGLEVDTTTRSYFTQLITPEDEKNGDQETKKDGFLMKGNTYTFQISQVEGGSNIHVKVRFSQKLLYQDHNFCLNVPFTFPAHVFPVFKKESYIEKILLNVNSGTSHITCNELKRKAGQLGFSYEADVVKWSSQDFYFSYSVCSNEIYGGLLLQSPSLHDYDQRDMFCFYLFPGSYQNMKPFKKEVVFVIDISGSMRDDPLEKTKYEIIGSLWKLNEGDSFNIIASNGDITSFSSSLELVTE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032290`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032290

Location Chr07:19990085-19998463 (-)

Description Similar to At1g17410: Probable nucleoside diphosphate kinase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17410`	Involved in the synthesis of nucleoside triphosphates other than ATP.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032290 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0003341 cilium movement Biological Process

GO:0003351 epithelial cilium movement involved in extracellular fluid movement Biological Process

GO:0006183 GTP biosynthetic process Biological Process

GO:0006228 UTP biosynthetic process Biological Process

GO:0006241 CTP biosynthetic process Biological Process

GO:0006308 DNA catabolic process Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0007286 spermatid development Biological Process

GO:0007618 mating Biological Process

GO:0009116 nucleoside metabolic process Biological Process

GO:0030317 flagellated sperm motility Biological Process

KEGG gene cross-reference

ath:AT1G17410

dre:436789

hsa:8382

mmu:75533

msu:MS0668

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.262

Rank 1 · LXL04_032290 · OH-1004

Cell membrane0.234

Rank 2 · LXL04_032290 · OH-1004

Cytoplasm0.209

Rank 3 · LXL04_032290 · OH-1004

Lysosome / Vacuole0.172

Rank 4 · LXL04_032290 · OH-1004

Golgi apparatus0.141

Rank 5 · LXL04_032290 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13768.13VWA_3203-360 aa

PF00092.35VWA204-360 aa

PF13519.13VWA_2204-309 aa

PF00334.25NDK721-855 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032290	`PF13768.13`	VWA_3	203	360	1.1e-10	42.5
LXL04_032290	`PF00092.35`	VWA	204	360	1.2e-08	36.1
LXL04_032290	`PF13519.13`	VWA_2	204	309	5.8e-07	30.8
LXL04_032290	`PF00334.25`	NDK	721	855	8.1e-42	143.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NLG3`	Arabidopsis thaliana	Probable nucleoside diphosphate kinase 5	61.940%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card