LXL04_032283 | RubberDandelionOmics

Gene overview

LXL04_032283

Reference: OH-1004 Chr: Chr07 Coordinates: 19914801-19915594 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

681 bp · LXL04_032283|LXL04_032283|OH1004|cDNA

ATGTCACCGGCTACACAATACACCAAGGCTCCGATGAAGAAGTCCGCTTTTGCACACACTTGCAATCAATTGAGCGTGTTTCTCAAAGAGAACGGCAGTCTCAGAGATCTTCAGCTTGGAATCAATGCCAAATTTGATGATACAGAAAAATCTCCGGCAGCGATTATGACTGTTGATTTGTTAAGCAGTATGGAAAATCCAGGCCAAAGTAGTGCACAAATCGAGAAATCAATGAATCTTCTTCCTCGGATTGGCACCTT...

CDS

Download CDS FASTA

681 bp · LXL04_032283|LXL04_032283|OH1004|CDS

ATGTCACCGGCTACACAATACACCAAGGCTCCGATGAAGAAGTCCGCTTTTGCACACACTTGCAATCAATTGAGCGTGTTTCTCAAAGAGAACGGCAGTCTCAGAGATCTTCAGCTTGGAATCAATGCCAAATTTGATGATACAGAAAAATCTCCGGCAGCGATTATGACTGTTGATTTGTTAAGCAGTATGGAAAATCCAGGCCAAAGTAGTGCACAAATCGAGAAATCAATGAATCTTCTTCCTCGGATTGGCACCTT...

Protein

Download Protein FASTA

226 aa · LXL04_032283|LXL04_032283|OH1004|PROTEIN

MSPATQYTKAPMKKSAFAHTCNQLSVFLKENGSLRDLQLGINAKFDDTEKSPAAIMTVDLLSSMENPGQSSAQIEKSMNLLPRIGTLDYLTTLEDSMTSSGSVAVSKGAQMTILYNGQVIVFDDISADRARDVMLAAGNCPPSTGKLDTGVELASTSNHPSDVLGLNQPIHVQFSANGLDLPIARRASLHKFLAKRKERAAVRAPYQLHSPAAGASKNELKFDLNL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032283`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032283

Location Chr07:19914801-19915594 (-)

Description Similar to TIFY10A: Protein TIFY 10A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g19180`	Repressor of jasmonate responses.	No verified direct reference in this release
`At1g74950`	Repressor of jasmonate responses.	No verified direct reference in this release
`At1g17380`	Repressor of jasmonate responses.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0615200`	Repressor of jasmonate responses.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032283 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:1900067 regulation of cellular response to alkaline pH Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G17380

ath:AT1G19180

ath:AT1G74950

dosa:Os07g0615200

gmx:100778559

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.882

Rank 1 · LXL04_032283 · OH-1004

Cytoplasm0.171

Rank 2 · LXL04_032283 · OH-1004

Cell membrane0.079

Rank 3 · LXL04_032283 · OH-1004

Endoplasmic reticulum0.055

Rank 4 · LXL04_032283 · OH-1004

Plastid0.020

Rank 5 · LXL04_032283 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06200.20tify107-138 aa

PF09425.16Jas_motif182-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032283	`PF06200.20`	tify	107	138	2.5e-14	53.0
LXL04_032283	`PF09425.16`	Jas_motif	182	207	7.3e-11	42.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMA8`	Arabidopsis thaliana	Protein TIFY 10A	38.565%	Swiss-Prot	moderate database homology
`Q9S7M2`	Arabidopsis thaliana	Protein TIFY 10B	33.190%	Swiss-Prot	moderate database homology
`Q9LDU5`	Arabidopsis thaliana	Protein TIFY 11A	32.000%	Swiss-Prot	moderate database homology
`Q8H395`	Oryza sativa subsp. japonica	Protein TIFY 10b	31.100%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card