LXL04_032238 | RubberDandelionOmics

Gene overview

LXL04_032238

Reference: OH-1004 Chr: Chr07 Coordinates: 19070882-19073965 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1323 bp · LXL04_032238|LXL04_032238|OH1004|cDNA

ATGGTATTTGCAGGGAGGCAGAAGAACAACAAGAATGCGGGAGAAGAATGGTATTTGGGGAAATACGAGATTGGAAGAACTCTTGGCGAAGGCAATTTCGGCAAGGTTAAATATGCTAAAGACATTCAAACTCAACACTCTTTTGCTATCAAGATCATTGACAAAACCCGCGTAATAAAGCTCAAAATATCCGATCAGATAAAGAGGGAGATCAGCGCATTGAAGCTTCTTAAACATCCTAACGTGGTTAGATTACACGA...

CDS

Download CDS FASTA

1323 bp · LXL04_032238|LXL04_032238|OH1004|CDS

ATGGTATTTGCAGGGAGGCAGAAGAACAACAAGAATGCGGGAGAAGAATGGTATTTGGGGAAATACGAGATTGGAAGAACTCTTGGCGAAGGCAATTTCGGCAAGGTTAAATATGCTAAAGACATTCAAACTCAACACTCTTTTGCTATCAAGATCATTGACAAAACCCGCGTAATAAAGCTCAAAATATCCGATCAGATAAAGAGGGAGATCAGCGCATTGAAGCTTCTTAAACATCCTAACGTGGTTAGATTACACGA...

Protein

Download Protein FASTA

440 aa · LXL04_032238|LXL04_032238|OH1004|PROTEIN

MVFAGRQKNNKNAGEEWYLGKYEIGRTLGEGNFGKVKYAKDIQTQHSFAIKIIDKTRVIKLKISDQIKREISALKLLKHPNVVRLHEVLASKTKIYMVLEYVNGGELFDTISTNGKQQESNARKLFQQLIDGVSYCHDRGVFHRDLKLENVLLDANGNIKISDFGLSALPEHIREDGLLHTTCGSPNYVAPEVLSNRGYDGRASDTWSCGVILYVMLTGYLPFDDRNLAVIYQKIAKGDARLPKWMSLGAKNLVKRILDP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032238`
TK1151 ID	TkA08G160580
OH-1004 ID	LXL04_032238
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032238

Location Chr07:19070882-19073965 (-)

Description Similar to CIPK1: CBL-interacting serine/threonine-protein kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g17510`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`At1g48260`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0292200`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os07g0637000`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os05g0136200`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032238 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G48260

ath:AT3G17510

dosa:Os01g0292200

dosa:Os05g0136200

dosa:Os07g0637000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.507

Rank 1 · LXL04_032238 · OH-1004

Nucleus0.369

Rank 2 · LXL04_032238 · OH-1004

Cell membrane0.223

Rank 3 · LXL04_032238 · OH-1004

Golgi apparatus0.056

Rank 4 · LXL04_032238 · OH-1004

Lysosome / Vacuole0.056

Rank 5 · LXL04_032238 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase22-277 aa

PF07714.24PK_Tyr_Ser-Thr23-272 aa

PF03109.23ABC172-169 aa

PF14531.13Kinase-like108-231 aa

PF03822.21NAF306-364 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032238	`PF00069.32`	Pkinase	22	277	2.1e-74	251.0
LXL04_032238	`PF07714.24`	PK_Tyr_Ser-Thr	23	272	5.3e-41	141.4
LXL04_032238	`PF03109.23`	ABC1	72	169	2e-06	27.9
LXL04_032238	`PF14531.13`	Kinase-like	108	231	6.5e-06	26.3
LXL04_032238	`PF03822.21`	NAF	306	364	1.4e-15	57.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWC9`	Arabidopsis thaliana	CBL-interacting serine/threonine-protein kinase 1	63.946%	Swiss-Prot	strong database homology
`Q94C40`	Arabidopsis thaliana	CBL-interacting serine/threonine-protein kinase 17	64.706%	Swiss-Prot	strong database homology
`Q9LGV5`	Oryza sativa subsp. japonica	CBL-interacting protein kinase 1	62.413%	Swiss-Prot	strong database homology
`Q0D4B2`	Oryza sativa subsp. japonica	CBL-interacting protein kinase 21	61.972%	Swiss-Prot	strong database homology
`Q75L42`	Oryza sativa subsp. japonica	CBL-interacting protein kinase 17	59.404%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card