LXL04_032237 | RubberDandelionOmics

Gene overview

LXL04_032237

Reference: OH-1004 Chr: Chr07 Coordinates: 19069240-19070560 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1008 bp · LXL04_032237|LXL04_032237|OH1004|cDNA

ATGTCTCCCACAAAATCGGTAGCTTGTTTAGTACTACTCTTCTTCTCATCTACTTTGCTTTCACACACTGCATCCCGCTTGCTCCCCGAAAGCCACGAGCAATGGATGGCCCGTTATGGACGTGTGTACAAGGATGCTCATGAGAAAGAACAACGTTCAAATATCTTTCATGAGAACGTTCAATACATAGAGTCATCCAACAATGCCATGAACAAAGGATACAAACTAGCGGTCAATGAGTTTGCAGACCTCACAAACGA...

CDS

Download CDS FASTA

1008 bp · LXL04_032237|LXL04_032237|OH1004|CDS

ATGTCTCCCACAAAATCGGTAGCTTGTTTAGTACTACTCTTCTTCTCATCTACTTTGCTTTCACACACTGCATCCCGCTTGCTCCCCGAAAGCCACGAGCAATGGATGGCCCGTTATGGACGTGTGTACAAGGATGCTCATGAGAAAGAACAACGTTCAAATATCTTTCATGAGAACGTTCAATACATAGAGTCATCCAACAATGCCATGAACAAAGGATACAAACTAGCGGTCAATGAGTTTGCAGACCTCACAAACGA...

Protein

Download Protein FASTA

335 aa · LXL04_032237|LXL04_032237|OH1004|PROTEIN

MSPTKSVACLVLLFFSSTLLSHTASRLLPESHEQWMARYGRVYKDAHEKEQRSNIFHENVQYIESSNNAMNKGYKLAVNEFADLTNEEFTTTRNRFKAHECSPSPSTFAFRYENVTVPTSMDWRKKGAVTPIKDQGQCGSCWAFSAVGAMEGVTQLKTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFDFILKNKGLTTETNYPYKASDGTCNNKEASNHAATITGHEDVPANSETSLLKAVSSQPISVAIDASGSDF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032237`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032237

Location Chr07:19069240-19070560 (+)

Description Similar to OsI_14861: Senescence-specific cysteine protease SAG39

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45890`	Cysteine protease that may have a developmental senescence specific cell death function during apoptosis, heavy metal detoxification, and hypersensitive response.	Identification of a promoter region responsible for the senescence-specific expression of SAG12.1999 · DOI: 10.1023/a:1006342412688 HDA6 is required for jasmonate response, senescence and flowering in Arabidopsis.2008 · DOI: 10.1093/jxb/erm300 Natural developmental variations in leaf and plant senescence in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1438-8677.2008.00108.x Epigenetic programming via histone methylation at WRKY53 controls leaf senescence in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1365-313x.2008.03782.x Nitric oxide is involved in cadmium-induced programmed cell death in Arabidopsis suspension cultures.2009 · DOI: 10.1104/pp.108.133397

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XQE8`	Cysteine protease that may have a developmental senescence specific cell death function during apoptosis, heavy metal detoxification, and hypersensitive response.	No verified direct reference in this release
`Os04g0206300`	Cysteine protease that may have a developmental senescence specific cell death function during apoptosis, heavy metal detoxification, and hypersensitive response.	No verified direct reference in this release
`Os11g0255300`	Cysteine endopeptidase that digests in vitro both the acidic and basic subunits of glutelin, the major seed storage protein of rice.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032237 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009749 response to glucose Biological Process

GO:0009750 response to fructose Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010224 response to UV-B Biological Process

KEGG gene cross-reference

ath:AT5G45890

dosa:Os11g0255300

osa:107276017

osa:4350216

rcu:8278243

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.615

Rank 1 · LXL04_032237 · OH-1004

Extracellular0.210

Rank 2 · LXL04_032237 · OH-1004

Cytoplasm0.201

Rank 3 · LXL04_032237 · OH-1004

Endoplasmic reticulum0.118

Rank 4 · LXL04_032237 · OH-1004

Cell membrane0.104

Rank 5 · LXL04_032237 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08246.18Inhibitor_I2932-89 aa

PF00112.30Peptidase_C1117-334 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032237	`PF08246.18`	Inhibitor_I29	32	89	3e-18	66.6
LXL04_032237	`PF00112.30`	Peptidase_C1	117	334	2.5e-85	286.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ47`	Arabidopsis thaliana	Senescence-specific cysteine protease SAG12	57.101%	Swiss-Prot	strong database homology
`A2XQE8`	Oryza sativa subsp. indica	Senescence-specific cysteine protease SAG39	59.091%	Swiss-Prot	strong database homology
`Q7XWK5`	Oryza sativa subsp. japonica	Senescence-specific cysteine protease SAG39	58.788%	Swiss-Prot	strong database homology
`Q7GDU7`	Oryza sativa subsp. japonica	Cysteine endopeptidase RepA	54.412%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card