Gene Card
Gene overview
cDNA / CDS / Protein Sequences
848 bp · LXL04_032236|LXL04_032236|OH1004|cDNA
ATGCCTGAAGATAAGAAAATCATAGGTCTTTCATGGGAACCAAAGCTACCTTCTTTTTTATTTGGCACAAAAAGTGTATCCGATGACAAGTCTCAAAATAAATCAGAAAACAGTCTGATATATAAACCCAACTCAGAGCTCATAGATGGACTCTTTGTTCCACCTAACGACCCAAAAAAGCTCAACAAGTTACTAAAGAAGCAAATCAAAGACACAACAGGAAAAAGCTGGTTTGATATGCCTGCCCCTACTCTCACACC...
594 bp · LXL04_032236|LXL04_032236|OH1004|CDS
ATGCCTGAAGATAAGAAAATCATAGGTCTTTCATGGGAACCAAAGCTACCTTCTTTTTTATTTGGCACAAAAAGTGTATCCGATGACAAGTCTCAAAATAAATCAGAAAACAGTCTGATATATAAACCCAACTCAGAGCTCATAGATGGACTCTTTGTTCCACCTAACGACCCAAAAAAGCTCAACAAGTTACTAAAGAAGCAAATCAAAGACACAACAGGAAAAAGCTGGTTTGATATGCCTGCCCCTACTCTCACACC...
Protein
Download Protein FASTA197 aa · LXL04_032236|LXL04_032236|OH1004|PROTEIN
MPEDKKIIGLSWEPKLPSFLFGTKSVSDDKSQNKSENSLIYKPNSELIDGLFVPPNDPKKLNKLLKKQIKDTTGKSWFDMPAPTLTPELKKDLQLIKLRNVIDPKRHYKKGDSKLNSFPKYFQVGTVVEPVSEYFTSRLTKRERKATLADELLSDQSLKVYRKRKVREIEEKSQPGGVDKWKIKGKSSWKRAKQRRH
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_032236 |
|---|---|
| TK1151 ID | TkA08G160540 |
| OH-1004 ID | LXL04_032236 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_032236 |
|---|---|
| Location | Chr07:19055743-19056970 (+) |
| Description | Similar to fcf2: rRNA-processing protein fcf2 (Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006364 rRNA processing Biological Process GO:0006396 RNA processing Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005694 chromosome Cellular Component GO:0005730 nucleolus Cellular Component |
| KEGG gene cross-reference | bta:511258 hsa:30836 mmu:99480 sce:YLR051C spo:2543250 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08698.17Fcf270-165 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_032236 | PF08698.17 | Fcf2 | 70 | 165 | 9.9e-38 | 129.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.