LXL04_032212 | RubberDandelionOmics

Gene overview

LXL04_032212

Reference: OH-1004 Chr: Chr07 Coordinates: 18693145-18694457 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

912 bp · LXL04_032212|LXL04_032212|OH1004|cDNA

ATGCAAGAACTGCTTAAGAAGAATTGTGATCCGGGTGTAGTTGGGTACCCGTCTCAGTGGACGGGTACCGAATCATTTGTTGAACAATCGACACTGTCTAATAACTTAAGTTTGAAAATGGGTTCTTCAACGCCACGTCAGCAAAACCCAAAGCAATTAGGGCTTCAAATTCAGTTTCAAGATCAAGATTCTTCGTCAACTCAATCCACCTGTCAATCTTACCCTGAAGTTGCGAGTGCTGGAGATAGTTATCCGTATGG...

CDS

Download CDS FASTA

912 bp · LXL04_032212|LXL04_032212|OH1004|CDS

ATGCAAGAACTGCTTAAGAAGAATTGTGATCCGGGTGTAGTTGGGTACCCGTCTCAGTGGACGGGTACCGAATCATTTGTTGAACAATCGACACTGTCTAATAACTTAAGTTTGAAAATGGGTTCTTCAACGCCACGTCAGCAAAACCCAAAGCAATTAGGGCTTCAAATTCAGTTTCAAGATCAAGATTCTTCGTCAACTCAATCCACCTGTCAATCTTACCCTGAAGTTGCGAGTGCTGGAGATAGTTATCCGTATGG...

Protein

Download Protein FASTA

303 aa · LXL04_032212|LXL04_032212|OH1004|PROTEIN

MQELLKKNCDPGVVGYPSQWTGTESFVEQSTLSNNLSLKMGSSTPRQQNPKQLGLQIQFQDQDSSSTQSTCQSYPEVASAGDSYPYGENKLSIQSALPTGVQDYAFAIQADRRQPYACIPFVYPDPYYRGLLAPYGPHSQAIMPQGMMMASTRVPLPLDYAQDEPIYVNAKQYNAILRRRQYRAKLEAQNKLLKPRKPYLHESRHVHALKRARGPGGRFLNMKKIQEDQQGGSMKEENDLGHGGGGGGGGGGACSEITSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032212`
TK1151 ID	TkA08G159550
OH-1004 ID	LXL04_032212
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032212

Location Chr07:18693145-18694457 (-)

Description Similar to NFYA3: Nuclear transcription factor Y subunit A-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72830`	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.	No verified direct reference in this release
`At1g17590`	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.	No verified direct reference in this release
`At1g54160`	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity).	No verified direct reference in this release
`At3g14020`	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.	No verified direct reference in this release
`At1g30500`	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032212 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009785 blue light signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010262 somatic embryogenesis Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048316 seed development Biological Process

GO:0005634 nucleus Cellular Component

GO:0016602 CCAAT-binding factor complex Cellular Component

KEGG gene cross-reference

ath:AT1G17590

ath:AT1G30500

ath:AT1G54160

ath:AT1G72830

ath:AT3G14020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.942

Rank 1 · LXL04_032212 · OH-1004

Cytoplasm0.161

Rank 2 · LXL04_032212 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_032212 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_032212 · OH-1004

Mitochondrion0.012

Rank 5 · LXL04_032212 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02045.22CBFB_NFYA136-232 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032212	`PF02045.22`	CBFB_NFYA	136	232	7.6e-35	120.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZH2`	Arabidopsis thaliana	Nuclear transcription factor Y subunit A-3	48.085%	Swiss-Prot	moderate database homology
`Q9LNP6`	Arabidopsis thaliana	Nuclear transcription factor Y subunit A-8	40.333%	Swiss-Prot	moderate database homology
`Q9SYH4`	Arabidopsis thaliana	Nuclear transcription factor Y subunit A-5	44.828%	Swiss-Prot	moderate database homology
`Q9LVJ7`	Arabidopsis thaliana	Nuclear transcription factor Y subunit A-6	44.292%	Swiss-Prot	moderate database homology
`Q84JP1`	Arabidopsis thaliana	Nuclear transcription factor Y subunit A-7	50.746%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card