LXL04_032113 | RubberDandelionOmics

Gene overview

LXL04_032113

Reference: OH-1004 Chr: Chr07 Coordinates: 16983454-16987287 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1401 bp · LXL04_032113|LXL04_032113|OH1004|cDNA

ATGGCGGTGGTTATGCATGTTTTGAACCAGCCAACGAAGCCTTTAATCACGTCGTCTTCGCCTTCAATCTCCGCCGCACATGACCGGAATTTCAGCTATTATGCTCATGTATCCAGCAGGTACCATCCGCTTCCGAGTACAAGTACCACCACTAGCAACAGCAGCAGCTGCAGATTGCATCGCATCACTTCTCAATTGCCCCTAAATTCATCGAAAACAGGTTATGGATGTTCATGGATGCAAGGCAACTCAAGCTATAA...

CDS

Download CDS FASTA

1401 bp · LXL04_032113|LXL04_032113|OH1004|CDS

ATGGCGGTGGTTATGCATGTTTTGAACCAGCCAACGAAGCCTTTAATCACGTCGTCTTCGCCTTCAATCTCCGCCGCACATGACCGGAATTTCAGCTATTATGCTCATGTATCCAGCAGGTACCATCCGCTTCCGAGTACAAGTACCACCACTAGCAACAGCAGCAGCTGCAGATTGCATCGCATCACTTCTCAATTGCCCCTAAATTCATCGAAAACAGGTTATGGATGTTCATGGATGCAAGGCAACTCAAGCTATAA...

Protein

Download Protein FASTA

466 aa · LXL04_032113|LXL04_032113|OH1004|PROTEIN

MAVVMHVLNQPTKPLITSSSPSISAAHDRNFSYYAHVSSRYHPLPSTSTTTSNSSSCRLHRITSQLPLNSSKTGYGCSWMQGNSSYKSLIANNERTHGPINSAFPSTPAQVSSVEDLFEFICSGPLIEKLGFTPETIGESIDKWLTNGFHVCELFNLNELYLTTPQKARIYHYYIPVFLWCEQQISDHRAAFKDGDDIPPLVIGFSAPQGCGKTTLVFALDYLFSKTSGRNLEGFKNFWHVICIRKSATISIDDFYLTYD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032113`
TK1151 ID	TkA08G151070
OH-1004 ID	LXL04_032113
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032113

Location Chr07:16983454-16987287 (+)

Description Similar to GLYK: D-glycerate 3-kinase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80380`	Catalyzes the concluding reaction of the photorespiratory C2 cycle, an indispensable ancillary metabolic pathway to the photosynthetic C3 cycle that enables land plants to grow in an oxygen- containing atmosphere.	D-GLYCERATE 3-KINASE, the last unknown enzyme in the photorespiratory cycle in Arabidopsis, belongs to a novel kinase family.2005 · DOI: 10.1105/tpc.105.033993 Light Controls Protein Localization through Phytochrome-Mediated Alternative Promoter Selection.2017 · DOI: 10.1016/j.cell.2017.10.018

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032113 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009853 photorespiration Biological Process

GO:0009854 oxidative photosynthetic carbon pathway Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008887 glycerate kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G80380

sce:YGR205W

spo:2543381

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.964

Rank 1 · LXL04_032113 · OH-1004

Mitochondrion0.054

Rank 2 · LXL04_032113 · OH-1004

Cytoplasm0.039

Rank 3 · LXL04_032113 · OH-1004

Nucleus0.025

Rank 4 · LXL04_032113 · OH-1004

Peroxisome0.022

Rank 5 · LXL04_032113 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q944I4`	Arabidopsis thaliana	D-glycerate 3-kinase, chloroplastic	67.246%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card