LXL04_032101 | RubberDandelionOmics

Gene overview

LXL04_032101

Reference: OH-1004 Chr: Chr07 Coordinates: 16801766-16807719 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4305 bp · LXL04_032101|LXL04_032101|OH1004|cDNA

ATGGAAGGGAGTGACATATATAAAGCTAGTAGGAGCATAAATTTAGGGAGTTTGAGAGCAGGGAGTGTAAGAACACCGAGTTTAAGATCTGGAAGTACTTCCGTATGGAGGAATTCTGCAAACGACGTGTTTTCAAAATCTGCTCATgaagaagacgatgaagaagCTCTTAAGTGGGCTTCACTTGAAAAGCTTCCGACTTTTGATCGATTAAGGAAAGGTTTGCTCTTAGGATCAAAAGGGCCTTCCAATGAAGTCGA...

CDS

Download CDS FASTA

4305 bp · LXL04_032101|LXL04_032101|OH1004|CDS

ATGGAAGGGAGTGACATATATAAAGCTAGTAGGAGCATAAATTTAGGGAGTTTGAGAGCAGGGAGTGTAAGAACACCGAGTTTAAGATCTGGAAGTACTTCCGTATGGAGGAATTCTGCAAACGACGTGTTTTCAAAATCTGCTCATGAAGAAGACGATGAAGAAGCTCTTAAGTGGGCTTCACTTGAAAAGCTTCCGACTTTTGATCGATTAAGGAAAGGTTTGCTCTTAGGATCAAAAGGGCCTTCCAATGAAGTCGA...

Protein

Download Protein FASTA

1434 aa · LXL04_032101|LXL04_032101|OH1004|PROTEIN

MEGSDIYKASRSINLGSLRAGSVRTPSLRSGSTSVWRNSANDVFSKSAHEEDDEEALKWASLEKLPTFDRLRKGLLLGSKGPSNEVDVNDLGFEQRQHLVDRLVKVADEDNEKFLMKLRNRIDRVGIDLPTIEVRFEHLTVEADVNTGSRALPSFVNFHIDIFEGLLNMLNLLPNSKRHITILDDVSGVIKPSRMTLLLGPPSSGKTTLLLALAGQLAKEIKSSGKVTYNGHELHEFIPERTAAYISQNDVHIGELTVRE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032101`
TK1151 ID	TkA08G150520
OH-1004 ID	LXL04_032101
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032101

Location Chr07:16801766-16807719 (-)

Description Similar to PDR1: Pleiotropic drug resistance protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15520`	May participate in transmembrane ABA import and associated signaling.	PDR-type ABC transporter mediates cellular uptake of the phytohormone abscisic acid.2010 · DOI: 10.1073/pnas.0909222107 ABA transport factors found in Arabidopsis ABC transporters.2010 · DOI: 10.4161/psb.5.9.12566 Arabidopsis Lectin Receptor Kinases LecRK-IX.1 and LecRK-IX.2 Are Functional Analogs in Regulating Phytophthora Resistance and Plant Cell Death.2015 · DOI: 10.1094/mpmi-02-15-0025-r Abscisic acid transporters cooperate to control seed germination.2015 · DOI: 10.1038/ncomms9113

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032101 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006952 defense response Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009914 hormone transport Biological Process

GO:0010193 response to ozone Biological Process

KEGG gene cross-reference

ath:AT1G15520

nta:107799533

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.653

Rank 1 · LXL04_032101 · OH-1004

Endoplasmic reticulum0.169

Rank 2 · LXL04_032101 · OH-1004

Cytoplasm0.111

Rank 3 · LXL04_032101 · OH-1004

Lysosome / Vacuole0.104

Rank 4 · LXL04_032101 · OH-1004

Golgi apparatus0.073

Rank 5 · LXL04_032101 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14510.12ABC_trans_N108-158 aa

PF00005.34ABC_tran183-365 aa

PF19055.7ABC2_membrane_7398-449 aa

PF01061.30ABC2_membrane519-731 aa

PF08370.17PDR_assoc740-802 aa

PF00005.34ABC_tran866-1018 aa

PF19055.7ABC2_membrane_71047-1107 aa

PF01061.30ABC2_membrane1164-1377 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032101	`PF14510.12`	ABC_trans_N	108	158	2.1e-08	35.1
LXL04_032101	`PF00005.34`	ABC_tran	183	365	8.9e-41	140.4
LXL04_032101	`PF19055.7`	ABC2_membrane_7	398	449	4.2e-12	46.4
LXL04_032101	`PF01061.30`	ABC2_membrane	519	731	1.5e-114	381.5
LXL04_032101	`PF08370.17`	PDR_assoc	740	802	5.5e-20	71.6
LXL04_032101	`PF00005.34`	ABC_tran	866	1018	8.9e-41	140.4
LXL04_032101	`PF19055.7`	ABC2_membrane_7	1047	1107	4.2e-12	46.4
LXL04_032101	`PF01061.30`	ABC2_membrane	1164	1377	1.5e-114	381.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9E1`	Arabidopsis thaliana	ABC transporter G family member 40	67.313%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card