LXL04_031905 | RubberDandelionOmics

Gene overview

LXL04_031905

Reference: OH-1004 Chr: Chr07 Coordinates: 12949630-12954368 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3708 bp · LXL04_031905|LXL04_031905|OH1004|cDNA

ATGGACAAATTTGATCAAGAAATGAAGGAAATGAACGGCTCATCAGGCAAACCAGACAACGATGAGAAAGAGAAGGCGCCACGTGGATTATTACGGATGTTATTGGAACATGCAGACCGGAGTGACATGGTTCTAATGGCATCGGGGACATGTGGGTGCTTTGTAGATGGGCTAAGTGTGTCTGTGATGATGTTGGTTTTCAGTCATTTGATGAATGTTTATGCTTCGGTATCTACTTTGACATCCGCAGACGTTAATCA...

CDS

Download CDS FASTA

3708 bp · LXL04_031905|LXL04_031905|OH1004|CDS

ATGGACAAATTTGATCAAGAAATGAAGGAAATGAACGGCTCATCAGGCAAACCAGACAACGATGAGAAAGAGAAGGCGCCACGTGGATTATTACGGATGTTATTGGAACATGCAGACCGGAGTGACATGGTTCTAATGGCATCGGGGACATGTGGGTGCTTTGTAGATGGGCTAAGTGTGTCTGTGATGATGTTGGTTTTCAGTCATTTGATGAATGTTTATGCTTCGGTATCTACTTTGACATCCGCAGACGTTAATCA...

Protein

Download Protein FASTA

1235 aa · LXL04_031905|LXL04_031905|OH1004|PROTEIN

MDKFDQEMKEMNGSSGKPDNDEKEKAPRGLLRMLLEHADRSDMVLMASGTCGCFVDGLSVSVMMLVFSHLMNVYASVSTLTSADVNQYALAFVYIAIVVGAGAFLEGFCWGRTAERQSSRIRTKYLKAILRQQVGYFDTTLEASRVTTSISTDMLNIHGVVSEKIPNFITNIWMFIAAEITGMYLCWRLAIVAVPAMFLLILPGSMYGKRLSTNEEKLQEAYAVAGGVAEQALSSIKTVHSYVGEDKMVKRFSTALGPTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031905`
TK1151 ID	TkA08G135340
OH-1004 ID	LXL04_031905
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.100
Protein coverage (%)	TK1151 100.000 / OH-1004 99.919 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031905

Location Chr07:12949630-12954368 (+)

Description Similar to Os02g0190300: Putative multidrug resistance protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28380`	ABC transporter B family member 17.	No verified direct reference in this release
`At3g28345`	ABC transporter B family member 15.	No verified direct reference in this release
`At3g28390`	ABC transporter B family member 18.	No verified direct reference in this release
`At3g28415`	ABC transporter B family member 22.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0190300`	Putative multidrug resistance protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031905 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0055085 transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042626 ATPase-coupled transmembrane transporter activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G28345

ath:AT3G28380

ath:AT3G28390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.492

Rank 1 · LXL04_031905 · OH-1004

Lysosome / Vacuole0.227

Rank 2 · LXL04_031905 · OH-1004

Endoplasmic reticulum0.150

Rank 3 · LXL04_031905 · OH-1004

Cytoplasm0.126

Rank 4 · LXL04_031905 · OH-1004

Golgi apparatus0.071

Rank 5 · LXL04_031905 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664.29ABC_membrane54-306 aa

PF00005.34ABC_tran384-533 aa

PF02463.26SMC_N486-577 aa

PF00664.29ABC_membrane670-931 aa

PF00005.34ABC_tran1007-1156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031905	`PF00664.29`	ABC_membrane	54	306	2.5e-89	300.3
LXL04_031905	`PF00005.34`	ABC_tran	384	533	9.5e-70	234.2
LXL04_031905	`PF02463.26`	SMC_N	486	577	9.7e-12	45.5
LXL04_031905	`PF00664.29`	ABC_membrane	670	931	2.5e-89	300.3
LXL04_031905	`PF00005.34`	ABC_tran	1007	1156	9.5e-70	234.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSJ6`	Arabidopsis thaliana	ABC transporter B family member 17	49.719%	Swiss-Prot	moderate database homology
`Q9LHD1`	Arabidopsis thaliana	ABC transporter B family member 15	50.692%	Swiss-Prot	strong database homology
`Q9LSJ5`	Arabidopsis thaliana	ABC transporter B family member 18	49.511%	Swiss-Prot	moderate database homology
`Q9LSJ2`	Arabidopsis thaliana	ABC transporter B family member 22	48.214%	Swiss-Prot	moderate database homology
`Q6YUU5`	Oryza sativa subsp. japonica	Putative multidrug resistance protein	51.475%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card