LXL04_031897 | RubberDandelionOmics

Gene overview

LXL04_031897

Reference: OH-1004 Chr: Chr07 Coordinates: 12847286-12848394 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

627 bp · LXL04_031897|LXL04_031897|OH1004|cDNA

ATGTGTCCAGGTAGGAATGGGTGGAGGTACAAGTGCGGGCCCAATAATTGCAGGTGTTGCAAAGTCACAACTCCTTTTCGGTTGAGGGTAGGAGAAGAGCGGTTTAAGCACAACAAGGAATGGCATTATGACACTTTAATTGTCATTCCAAATGACAAATTACTTACCCCAATTTCCCCATCTACCCTTGTGACCGAACATTTTAATTTAGCCGATGATATCCTCCGACAGGGTGCTCGTGGAATTTCCAATATAAATAC...

CDS

Download CDS FASTA

627 bp · LXL04_031897|LXL04_031897|OH1004|CDS

ATGTGTCCAGGTAGGAATGGGTGGAGGTACAAGTGCGGGCCCAATAATTGCAGGTGTTGCAAAGTCACAACTCCTTTTCGGTTGAGGGTAGGAGAAGAGCGGTTTAAGCACAACAAGGAATGGCATTATGACACTTTAATTGTCATTCCAAATGACAAATTACTTACCCCAATTTCCCCATCTACCCTTGTGACCGAACATTTTAATTTAGCCGATGATATCCTCCGACAGGGTGCTCGTGGAATTTCCAATATAAATAC...

Protein

Download Protein FASTA

208 aa · LXL04_031897|LXL04_031897|OH1004|PROTEIN

MCPGRNGWRYKCGPNNCRCCKVTTPFRLRVGEERFKHNKEWHYDTLIVIPNDKLLTPISPSTLVTEHFNLADDILRQGARGISNINTIPGSVNVDFADVRAIVANAGSSLVGIRTETANVIYDLVDPTAYLIFGAVIDPSISSAVRLLCYNHRTNQNNLSCIELRHMSVSITLITTGVKGEQESDYPLIQEHYDIITSESRFSLKMAF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031897`
TK1151 ID	TkA08G134880
OH-1004 ID	LXL04_031897
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031897

Location Chr07:12847286-12848394 (+)

Description Similar to FTSZ2-1: Cell division protein FtsZ homolog 2-1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36250`	Exhibits GTPase activity which converts GTP ligands to GDP.	Chloroplast division and morphology are differentially affected by overexpression of FtsZ1 and FtsZ2 genes in Arabidopsis.2000 · DOI: 10.1104/pp.124.4.1668 Plant FtsZ1 and FtsZ2 expressed in a eukaryotic host: GTPase activity and self-assembly.2010 · DOI: 10.1016/j.febslet.2009.11.044 Arabidopsis FtsZ2-1 and FtsZ2-2 are functionally redundant, but FtsZ-based plastid division is not essential for chloroplast partitioning or plant growth and development.2009 · DOI: 10.1093/mp/ssp077 Differential impacts of FtsZ proteins on plastid division in the shoot apex of Arabidopsis.2018 · DOI: 10.1016/j.ydbio.2018.06.010 Chloroplast division in higher plants requires members of two functionally divergent gene families with homology to bacterial ftsZ.1998 · DOI: 10.1105/tpc.10.12.1991
`At3g52750`	Exhibits GTPase activity (By similarity).	Arabidopsis FtsZ2-1 and FtsZ2-2 are functionally redundant, but FtsZ-based plastid division is not essential for chloroplast partitioning or plant growth and development.2009 · DOI: 10.1093/mp/ssp077 Differential impacts of FtsZ proteins on plastid division in the shoot apex of Arabidopsis.2018 · DOI: 10.1016/j.ydbio.2018.06.010
`At5g55280`	Exhibits GTPase activity.	Chloroplast division and morphology are differentially affected by overexpression of FtsZ1 and FtsZ2 genes in Arabidopsis.2000 · DOI: 10.1104/pp.124.4.1668 Effects of mutations in Arabidopsis FtsZ1 on plastid division, FtsZ ring formation and positioning, and FtsZ filament morphology in vivo.2007 · DOI: 10.1093/pcp/pcm049 Developmentally regulated association of plastid division protein FtsZ1 with thylakoid membranes in Arabidopsis thaliana.2008 · DOI: 10.1042/bj20070543 Plant FtsZ1 and FtsZ2 expressed in a eukaryotic host: GTPase activity and self-assembly.2010 · DOI: 10.1016/j.febslet.2009.11.044 FtsZ1/FtsZ2 Turnover in Chloroplasts and the Role of ARC3.2015 · DOI: 10.1017/s1431927615000082 The Arabidopsis minE mutation causes new plastid and FtsZ1 localization phenotypes in the leaf epidermis.2015 · DOI: 10.3389/fpls.2015.00823 Differential impacts of FtsZ proteins on plastid division in the shoot apex of Arabidopsis.2018 · DOI: 10.1016/j.ydbio.2018.06.010 Chloroplast division in higher plants requires members of two functionally divergent gene families with homology to bacterial ftsZ.1998 · DOI: 10.1105/tpc.10.12.1991

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031897 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007017 microtubule-based process Biological Process

GO:0009612 response to mechanical stimulus Biological Process

GO:0009637 response to blue light Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009902 chloroplast relocation Biological Process

GO:0010020 chloroplast fission Biological Process

GO:0032506 cytokinetic process Biological Process

GO:0043093 FtsZ-dependent cytokinesis Biological Process

GO:0043572 plastid fission Biological Process

GO:0051258 protein polymerization Biological Process

GO:0051301 cell division Biological Process

KEGG gene cross-reference

ana:alr3858

ath:AT2G36250

ath:AT3G52750

ath:AT5G55280

syn:sll1633

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.337

Rank 1 · LXL04_031897 · OH-1004

Nucleus0.299

Rank 2 · LXL04_031897 · OH-1004

Mitochondrion0.177

Rank 3 · LXL04_031897 · OH-1004

Cell membrane0.099

Rank 4 · LXL04_031897 · OH-1004

Extracellular0.094

Rank 5 · LXL04_031897 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82533`	Arabidopsis thaliana	Cell division protein FtsZ homolog 2-1, chloroplastic	45.000%	Swiss-Prot	moderate database homology
`Q9LXJ0`	Arabidopsis thaliana	Cell division protein FtsZ homolog 2-2, chloroplastic	43.777%	Swiss-Prot	moderate database homology
`Q42545`	Arabidopsis thaliana	Cell division protein FtsZ homolog 1, chloroplastic	36.095%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card