RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_031855
Reference: OH-1004 Chr: Chr07 Coordinates: 12250046-12252682 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1080 bp · LXL04_031855|LXL04_031855|OH1004|cDNA

ATGTTTAATGAACCTATGAAGAGATTCGATTGGTTTAAGCCGATTTCCAACAATGGGAAATTGGAGCGGAGGTTATCACTTGGGGAATACAAAAGAGCGGTTTCATGGTCGAAGTATTTGGTGTCTTCTGGAGGTGAGATAAAGGCGAaaggggaagaagaagaagaactggAATGGAGTGCTGATATGTCGCAGTTGTTTATTGGGAATAAATTCGCCATGGGAAGACATAGTAGGATTTACAGAGGGGTTTATAAGCA...

CDS

Download CDS FASTA

1080 bp · LXL04_031855|LXL04_031855|OH1004|CDS

ATGTTTAATGAACCTATGAAGAGATTCGATTGGTTTAAGCCGATTTCCAACAATGGGAAATTGGAGCGGAGGTTATCACTTGGGGAATACAAAAGAGCGGTTTCATGGTCGAAGTATTTGGTGTCTTCTGGAGGTGAGATAAAGGCGAAAGGGGAAGAAGAAGAAGAACTGGAATGGAGTGCTGATATGTCGCAGTTGTTTATTGGGAATAAATTCGCCATGGGAAGACATAGTAGGATTTACAGAGGGGTTTATAAGCA...

Protein

Download Protein FASTA

359 aa · LXL04_031855|LXL04_031855|OH1004|PROTEIN

MFNEPMKRFDWFKPISNNGKLERRLSLGEYKRAVSWSKYLVSSGGEIKAKGEEEEELEWSADMSQLFIGNKFAMGRHSRIYRGVYKHNDVAVKLISQPEEDRELASILERQFTSEVAMLFRLQHPNIITFFAACKKPPVFCIINEYLSGGSLRAYLHQQEPYSLHPNLVLKLAIDIARGMQYLHSQGILHRDLKSENLLLGEDMCVKVADFGISCLESQCGSAKGFTGTYRWMAPEMIKEKKHTKKIDVYSFAIVMWELL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_031855
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_031855
LocationChr07:12250046-12252682 (+)
DescriptionSimilar to HT1: Serine/threonine/tyrosine-protein kinase HT1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g62400 Serine/threonine/tyrosine kinase involved in the control of stomatal movement in response to CO(2). No verified direct reference in this release
At2g24360 Serine/threonine protein kinase that phosphorylates proteins on serine, threonine and tyrosine residues.
Genome-wide analysis and experimentation of plant serine/ threonine/tyrosine-specific protein kinases.2006 · DOI: 10.1007/s11103-005-4109-7
At4g38470 Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).
A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200
The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
At2g17700 Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).
A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200
The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
At4g35780 Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).
A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200
The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031855 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0007165 signal transduction Biological Process
GO:0009658 chloroplast organization Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0010119 regulation of stomatal movement Biological Process
GO:0010344 seed oilbody biogenesis Biological Process
GO:0045995 regulation of embryonic development Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0071244 cellular response to carbon dioxide Biological Process
GO:0071456 cellular response to hypoxia Biological Process
GO:0090333 regulation of stomatal closure Biological Process
GO:2000030 regulation of response to red or far red light Biological Process
KEGG gene cross-reference
ath:AT1G62400
ath:AT2G17700
ath:AT2G24360
ath:AT4G35780
ath:AT4G38470
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.560
Rank 1 · LXL04_031855 · OH-1004
Cell membrane0.313
Rank 2 · LXL04_031855 · OH-1004
Nucleus0.266
Rank 3 · LXL04_031855 · OH-1004
Golgi apparatus0.088
Rank 4 · LXL04_031855 · OH-1004
Mitochondrion0.057
Rank 5 · LXL04_031855 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr69-320 aa
PF00069.32Pkinase75-318 aa
PF17667.8Pkinase_fungal173-255 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_031855PF07714.24PK_Tyr_Ser-Thr693201.7e-61208.5
LXL04_031855PF00069.32Pkinase753181.9e-53182.3
LXL04_031855PF17667.8Pkinase_fungal1732554.4e-0833.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q2MHE4Arabidopsis thalianaSerine/threonine/tyrosine-protein kinase HT163.300%Swiss-Protstrong database homology
Q9ZQ31Arabidopsis thalianaSerine/threonine-protein kinase STY1346.667%Swiss-Protmoderate database homology
F4JTP5Arabidopsis thalianaSerine/threonine-protein kinase STY4644.106%Swiss-Protmoderate database homology
O22558Arabidopsis thalianaSerine/threonine-protein kinase STY838.944%Swiss-Protmoderate database homology
Q8RWL6Arabidopsis thalianaSerine/threonine-protein kinase STY1741.392%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser