LXL04_031852 | RubberDandelionOmics

Gene overview

LXL04_031852

Reference: OH-1004 Chr: Chr07 Coordinates: 12217805-12218438 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

462 bp · LXL04_031852|LXL04_031852|OH1004|cDNA

ATGGTGGGATTTAAAAATCGGTACATGATAATGGAGGTGTCTGTGGATCCAAATAAAGATATATCAAAAGACGATCCCATTATTCTTAGCCAACATAACATATCCAAAGCAATCAAAGACAGCATTCTCATTAACTTTGGAGAGTGTGGTCTTGCATCTTCACTAGGATCATTACAAGTAAAATATGTGAATCCAATCACGAAAGTATGCATTATCAGAGCTTCAAGGGAGGATCATAAAAAGGTTTTGGCTGCAATTAC...

CDS

Download CDS FASTA

462 bp · LXL04_031852|LXL04_031852|OH1004|CDS

ATGGTGGGATTTAAAAATCGGTACATGATAATGGAGGTGTCTGTGGATCCAAATAAAGATATATCAAAAGACGATCCCATTATTCTTAGCCAACATAACATATCCAAAGCAATCAAAGACAGCATTCTCATTAACTTTGGAGAGTGTGGTCTTGCATCTTCACTAGGATCATTACAAGTAAAATATGTGAATCCAATCACGAAAGTATGCATTATCAGAGCTTCAAGGGAGGATCATAAAAAGGTTTTGGCTGCAATTAC...

Protein

Download Protein FASTA

153 aa · LXL04_031852|LXL04_031852|OH1004|PROTEIN

MVGFKNRYMIMEVSVDPNKDISKDDPIILSQHNISKAIKDSILINFGECGLASSLGSLQVKYVNPITKVCIIRASREDHKKVLAAITMVRSVGNCPVVFNLLDLSGNIRACRSAALKCEELEFEKLKIVSGVPRTEDVNKHMQNLERIKMLEH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031852`
TK1151 ID	TkA08G132670
OH-1004 ID	LXL04_031852
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031852

Location Chr07:12217805-12218438 (-)

Description Similar to EMB1687: Probable ribonuclease P/MRP protein subunit POP5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04635`	Essential protein required during embryogenesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031852 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0001682 tRNA 5'-leader removal Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006396 RNA processing Biological Process

GO:0008033 tRNA processing Biological Process

GO:0000172 ribonuclease MRP complex Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005655 nucleolar ribonuclease P complex Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0030681 multimeric ribonuclease P complex Cellular Component

KEGG gene cross-reference

ath:AT1G04635

bta:507410

ddi:DDB_G0291662

hsa:51367

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.737

Rank 1 · LXL04_031852 · OH-1004

Cytoplasm0.270

Rank 2 · LXL04_031852 · OH-1004

Mitochondrion0.044

Rank 3 · LXL04_031852 · OH-1004

Cell membrane0.025

Rank 4 · LXL04_031852 · OH-1004

Lysosome / Vacuole0.015

Rank 5 · LXL04_031852 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01900.25RNase_P_Rpp147-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031852	`PF01900.25`	RNase_P_Rpp14	7	115	1.3e-28	99.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6AWV1`	Arabidopsis thaliana	Probable ribonuclease P/MRP protein subunit POP5	62.338%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card