LXL04_031844 | RubberDandelionOmics

Gene overview

LXL04_031844

Reference: OH-1004 Chr: Chr07 Coordinates: 12156920-12159538 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1875 bp · LXL04_031844|LXL04_031844|OH1004|cDNA

ATGGATCAAATTCGATCCAATTTATGTGTTTTGTTATTCTTCTTTTTACTTTTTTCATCCGCAAGAACAGAAGATGTAGGTGTAATCCAGGCATTGGTCACATTCATGAATAATCTGAAGCCAACTCAAACCACCCCAAATTGGGGATGGAACATTTCATCGGATCCATGCACAAGTAAATGGGTCGGGGTTACTTGCGATAAAAGCAACGTAACCGTAAAAAAAATCGTCCTTGAAATTGTTAATCTATCAGGAACACT...

CDS

Download CDS FASTA

1875 bp · LXL04_031844|LXL04_031844|OH1004|CDS

ATGGATCAAATTCGATCCAATTTATGTGTTTTGTTATTCTTCTTTTTACTTTTTTCATCCGCAAGAACAGAAGATGTAGGTGTAATCCAGGCATTGGTCACATTCATGAATAATCTGAAGCCAACTCAAACCACCCCAAATTGGGGATGGAACATTTCATCGGATCCATGCACAAGTAAATGGGTCGGGGTTACTTGCGATAAAAGCAACGTAACCGTAAAAAAAATCGTCCTTGAAATTGTTAATCTATCAGGAACACT...

Protein

Download Protein FASTA

624 aa · LXL04_031844|LXL04_031844|OH1004|PROTEIN

MDQIRSNLCVLLFFFLLFSSARTEDVGVIQALVTFMNNLKPTQTTPNWGWNISSDPCTSKWVGVTCDKSNVTVKKIVLEIVNLSGTLDFTSLCKASNLLVLSLNFNNLTGTLSPEISNCNRLTHFYLTGNRFSGAIPGSLADLPNVKRIVISNNDFSGELPDFSRTTSLLTFFAQNNRFTGQLPVFNYNQLQEFNVANNNLTGPVPDDTGRFDGNSFTGNPGLCGKVLPQSCPVKKKGKKSKLRDFLIYSGYVVLGFLIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031844`
TK1151 ID	TkA08G132520
OH-1004 ID	LXL04_031844
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.700
Protein coverage (%)	TK1151 97.817 / OH-1004 35.897 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031844

Location Chr07:12156920-12159538 (+)

Description Similar to At2g26730: Probable inactive receptor kinase At2g26730

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26730`	Probable inactive receptor kinase At2g26730.	No verified direct reference in this release
`At1g60630`	Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630.	No verified direct reference in this release
`At5g05160`	Probable leucine-rich repeat receptor-like protein kinase.	No verified direct reference in this release
`At5g16590`	Might be involved in early recognition of growth promoting fungi.	A leucine-rich repeat protein is required for growth promotion and enhanced seed production mediated by the endophytic fungus Piriformospora indica in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03028.x
`At5g53320`	Probable inactive receptor kinase At5g53320.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031844 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009610 response to symbiotic fungus Biological Process

GO:2000605 positive regulation of secondary growth Biological Process

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G60630

ath:AT2G26730

ath:AT5G05160

ath:AT5G16590

ath:AT5G53320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.895

Rank 1 · LXL04_031844 · OH-1004

Endoplasmic reticulum0.076

Rank 2 · LXL04_031844 · OH-1004

Cytoplasm0.067

Rank 3 · LXL04_031844 · OH-1004

Nucleus0.046

Rank 4 · LXL04_031844 · OH-1004

Lysosome / Vacuole0.019

Rank 5 · LXL04_031844 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_230-67 aa

PF13855.13LRR_897-156 aa

PF00069.32Pkinase341-529 aa

PF07714.24PK_Tyr_Ser-Thr344-589 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031844	`PF08263.18`	LRRNT_2	30	67	7.6e-06	26.8
LXL04_031844	`PF13855.13`	LRR_8	97	156	3.5e-06	27.4
LXL04_031844	`PF00069.32`	Pkinase	341	529	9.7e-17	61.9
LXL04_031844	`PF07714.24`	PK_Tyr_Ser-Thr	344	589	5.2e-17	62.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48788`	Arabidopsis thaliana	Probable inactive receptor kinase At2g26730	36.164%	Swiss-Prot	moderate database homology
`Q84MA9`	Arabidopsis thaliana	Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630	34.259%	Swiss-Prot	moderate database homology
`Q9FHK7`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At5g05160	33.645%	Swiss-Prot	moderate database homology
`Q9FMD7`	Arabidopsis thaliana	Probable inactive receptor kinase At5g16590	32.965%	Swiss-Prot	moderate database homology
`Q9FK10`	Arabidopsis thaliana	Probable inactive receptor kinase At5g53320	33.868%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card