LXL04_031834 | RubberDandelionOmics

Gene overview

LXL04_031834

Reference: OH-1004 Chr: Chr07 Coordinates: 12005629-12007768 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1776 bp · LXL04_031834|LXL04_031834|OH1004|cDNA

ATGAAAGACAGCAACACCGGCGTCGAGTCGCCGCTACTCAGCAACTACGTCGACGGCTTTGTCGACTACAGAGGCCGTCCGGTTCTCAGATCAAAGTCCGGTTGCTGGCGATCAGCATATTTCATCATTGGCGTAGAAGTGGCGGAGAGATTCGCATACTATGGCGTCATATCTAATCTAATCACGTACCTTACCGGACCCTTGGGGCAATCGACGGCCACAGCTGCCCAAAATGTCAACACGTGGTCGGGAATCTCGAA...

CDS

Download CDS FASTA

1776 bp · LXL04_031834|LXL04_031834|OH1004|CDS

ATGAAAGACAGCAACACCGGCGTCGAGTCGCCGCTACTCAGCAACTACGTCGACGGCTTTGTCGACTACAGAGGCCGTCCGGTTCTCAGATCAAAGTCCGGTTGCTGGCGATCAGCATATTTCATCATTGGCGTAGAAGTGGCGGAGAGATTCGCATACTATGGCGTCATATCTAATCTAATCACGTACCTTACCGGACCCTTGGGGCAATCGACGGCCACAGCTGCCCAAAATGTCAACACGTGGTCGGGAATCTCGAA...

Protein

Download Protein FASTA

591 aa · LXL04_031834|LXL04_031834|OH1004|PROTEIN

MKDSNTGVESPLLSNYVDGFVDYRGRPVLRSKSGCWRSAYFIIGVEVAERFAYYGVISNLITYLTGPLGQSTATAAQNVNTWSGISKLLPLVGAFIADAFLGRYLTIIIASLLYVLALAFLTLSTLSPPNCKTVNGESSSCSSQLHVIMFFMSLYLVAFAQGGHKPCVQAFGADQFDAGNPQERKAKNSFFNWWYFGLCTGPIVGIFVVSYIQDNHSWGLGFGIPCIIMAFALIIFLIGTTTYRFGEKTEEKSAFSRIGH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031834`
TK1151 ID	TkA08G132090
OH-1004 ID	LXL04_031834
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.000
Protein coverage (%)	TK1151 95.169 / OH-1004 66.667 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031834

Location Chr07:12005629-12007768 (-)

Description Similar to NPF5.10: Protein NRT1/ PTR FAMILY 5.10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22540`	Protein NRT1/ PTR FAMILY 5.10.	No verified direct reference in this release
`At1g72125`	Protein NRT1/ PTR FAMILY 5.13.	No verified direct reference in this release
`At1g22550`	Protein NRT1/ PTR FAMILY 5.16.	No verified direct reference in this release
`At1g72120`	Protein NRT1/ PTR FAMILY 5.14.	No verified direct reference in this release
`At1g22570`	Protein NRT1/ PTR FAMILY 5.15.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031834 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015706 nitrate transmembrane transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0022857 transmembrane transporter activity Molecular Function

GO:0042937 tripeptide transmembrane transporter activity Molecular Function

GO:0071916 dipeptide transmembrane transporter activity Molecular Function

GO:0080054 low-affinity nitrate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G22540

ath:AT1G22550

ath:AT1G22570

ath:AT1G72120

ath:AT1G72125

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.617

Rank 1 · LXL04_031834 · OH-1004

Lysosome / Vacuole0.154

Rank 2 · LXL04_031834 · OH-1004

Endoplasmic reticulum0.110

Rank 3 · LXL04_031834 · OH-1004

Cytoplasm0.068

Rank 4 · LXL04_031834 · OH-1004

Golgi apparatus0.041

Rank 5 · LXL04_031834 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690.22MFS_151-503 aa

PF00854.28PTR2104-522 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031834	`PF07690.22`	MFS_1	51	503	5.5e-13	49.3
LXL04_031834	`PF00854.28`	PTR2	104	522	3.1e-90	303.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WP01`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 5.10	60.958%	Swiss-Prot	strong database homology
`Q0WSZ6`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 5.13	55.433%	Swiss-Prot	strong database homology
`Q9SK96`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 5.16	54.144%	Swiss-Prot	strong database homology
`Q8VZE2`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 5.14	53.710%	Swiss-Prot	strong database homology
`Q9SK99`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 5.15	52.886%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card