LXL04_031809 | RubberDandelionOmics

Gene overview

LXL04_031809

Reference: OH-1004 Chr: Chr07 Coordinates: 11566136-11568285 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1209 bp · LXL04_031809|LXL04_031809|OH1004|cDNA

ATGGGGGGATGGCGATTTGAAGAAGATCGTGAGATAACTTTTCCTCACACTCTTGTTTTGATTGGAAAGACTGGAAACGGGAAAAACGCTACAGGGAATACCATTCTAGGAAAGCAATTGTTTCGATCTTTGCGTAGTTTATCTGCTATAACAATTACCTCAGAGTTGAAGACAACTACACTGGAAAAGGGCCAGCCTCTTAACGTTATCGATACTCCTGGTTCTAATTTATTTTATGTCGAGTTTATTAAGAAGGAGAT...

CDS

Download CDS FASTA

1209 bp · LXL04_031809|LXL04_031809|OH1004|CDS

ATGGGGGGATGGCGATTTGAAGAAGATCGTGAGATAACTTTTCCTCACACTCTTGTTTTGATTGGAAAGACTGGAAACGGGAAAAACGCTACAGGGAATACCATTCTAGGAAAGCAATTGTTTCGATCTTTGCGTAGTTTATCTGCTATAACAATTACCTCAGAGTTGAAGACAACTACACTGGAAAAGGGCCAGCCTCTTAACGTTATCGATACTCCTGGTTCTAATTTATTTTATGTCGAGTTTATTAAGAAGGAGAT...

Protein

Download Protein FASTA

402 aa · LXL04_031809|LXL04_031809|OH1004|PROTEIN

MGGWRFEEDREITFPHTLVLIGKTGNGKNATGNTILGKQLFRSLRSLSAITITSELKTTTLEKGQPLNVIDTPGSNLFYVEFIKKEIVNCINMAKDGFNAFLVVISVRMRFAEDDKAAINSMVDLFGRKFYNYTIIVFTGGDELEYFEESFRDFLKNSPESLKDALHQCRNRCVLFDNKTDDLTKRANQLKKLFSLVNAVSRANGGKPYTYELFTELKFESRLKETTLKLERLLEKECTARLMTNKEIIRVKLISIILFV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031809`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031809

Location Chr07:11566136-11568285 (-)

Description Similar to IAN9: Immune-associated nucleotide-binding protein 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g33970`	Immune-associated nucleotide-binding protein 9.	No verified direct reference in this release
`At4g09940`	Immune-associated nucleotide-binding protein 12.	No verified direct reference in this release
`At1g33900`	Immune-associated nucleotide-binding protein 4.	No verified direct reference in this release
`At1g33950`	Immune-associated nucleotide-binding protein 7.	No verified direct reference in this release
`At2g26820`	Immune-associated nucleotide-binding protein 10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031809 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0034605 cellular response to heat Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0005525 GTP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT1G33900

ath:AT1G33950

ath:AT1G33970

ath:AT2G26820

ath:AT4G09940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.628

Rank 1 · LXL04_031809 · OH-1004

Nucleus0.208

Rank 2 · LXL04_031809 · OH-1004

Cell membrane0.182

Rank 3 · LXL04_031809 · OH-1004

Mitochondrion0.123

Rank 4 · LXL04_031809 · OH-1004

Endoplasmic reticulum0.085

Rank 5 · LXL04_031809 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04548.23AIG117-222 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031809	`PF04548.23`	AIG1	17	222	5e-59	199.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HT21`	Arabidopsis thaliana	Immune-associated nucleotide-binding protein 9	44.479%	Swiss-Prot	moderate database homology
`Q9T0F3`	Arabidopsis thaliana	Immune-associated nucleotide-binding protein 12	37.134%	Swiss-Prot	moderate database homology
`Q9C8U7`	Arabidopsis thaliana	Immune-associated nucleotide-binding protein 4	39.713%	Swiss-Prot	moderate database homology
`Q9C8V2`	Arabidopsis thaliana	Immune-associated nucleotide-binding protein 7	37.091%	Swiss-Prot	moderate database homology
`O81025`	Arabidopsis thaliana	Immune-associated nucleotide-binding protein 10	39.910%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card