LXL04_031807 | RubberDandelionOmics

Gene overview

LXL04_031807

Reference: OH-1004 Chr: Chr07 Coordinates: 11523982-11526205 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

818 bp · LXL04_031807|LXL04_031807|OH1004|cDNA

ATGAGAGTGAAAACAAGGGCATCAGTGATGGGGCGGTATCCGCTTGAAGAAGATTACGAGTATATTTCGCCTCGAACTCTTGTTTTGGTGGGAAAAACCGGAAATGGGAAAAGTAGTACAGGCAATTCAATTCTTGGAACGCAGGTGTTCAAATCCAAGCTCAGTCCATCTAGTGTAACAAGAACATCCGAGTTGCAGAGAAAGGCATTGGATGATGGCCAGACACTTATTGTGATTGATACTCCCGGACTCTTTGATTC...

CDS

Download CDS FASTA

579 bp · LXL04_031807|LXL04_031807|OH1004|CDS

ATGAGAGTGAAAACAAGGGCATCAGTGATGGGGCGGTATCCGCTTGAAGAAGATTACGAGTATATTTCGCCTCGAACTCTTGTTTTGGTGGGAAAAACCGGAAATGGGAAAAGTAGTACAGGCAATTCAATTCTTGGAACGCAGGTGTTCAAATCCAAGCTCAGTCCATCTAGTGTAACAAGAACATCCGAGTTGCAGAGAAAGGCATTGGATGATGGCCAGACACTTATTGTGATTGATACTCCCGGACTCTTTGATTC...

Protein

Download Protein FASTA

192 aa · LXL04_031807|LXL04_031807|OH1004|PROTEIN

MRVKTRASVMGRYPLEEDYEYISPRTLVLVGKTGNGKSSTGNSILGTQVFKSKLSPSSVTRTSELQRKALDDGQTLIVIDTPGLFDSSHEFKFIREEIVSCIHKAKDGIDAFLFVISIQNRFTGDEPDAINSLRTLFGSKFYDYMIIVFTNGDALERDNQSLEDFLSESPKSFQETSTCVRIGVLFFITILL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031807`
TK1151 ID	TkA08G130810
OH-1004 ID	LXL04_031807
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.300
Protein coverage (%)	TK1151 63.309 / OH-1004 91.667 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031807

Location Chr07:11523982-11526205 (-)

Description Similar to IAN12: Immune-associated nucleotide-binding protein 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g09940`	Immune-associated nucleotide-binding protein 12.	No verified direct reference in this release
`At4g09950`	Immune-associated nucleotide-binding protein 13.	No verified direct reference in this release
`At1g33970`	Immune-associated nucleotide-binding protein 9.	No verified direct reference in this release
`At1g33930`	Immune-associated nucleotide-binding protein 6.	No verified direct reference in this release
`At1g33950`	Immune-associated nucleotide-binding protein 7.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031807 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0034605 cellular response to heat Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0005525 GTP binding Molecular Function

KEGG gene cross-reference

ath:AT1G33930

ath:AT1G33950

ath:AT1G33970

ath:AT4G09940

ath:AT4G09950

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.436

Rank 1 · LXL04_031807 · OH-1004

Endoplasmic reticulum0.170

Rank 2 · LXL04_031807 · OH-1004

Nucleus0.164

Rank 3 · LXL04_031807 · OH-1004

Mitochondrion0.158

Rank 4 · LXL04_031807 · OH-1004

Cell membrane0.139

Rank 5 · LXL04_031807 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04548.23AIG125-175 aa

PF01926.30MMR_HSR127-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031807	`PF04548.23`	AIG1	25	175	5.1e-53	180.3
LXL04_031807	`PF01926.30`	MMR_HSR1	27	129	1.8e-09	38.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T0F3`	Arabidopsis thaliana	Immune-associated nucleotide-binding protein 12	50.299%	Swiss-Prot	strong database homology
`Q9T0F4`	Arabidopsis thaliana	Immune-associated nucleotide-binding protein 13	46.369%	Swiss-Prot	moderate database homology
`F4HT21`	Arabidopsis thaliana	Immune-associated nucleotide-binding protein 9	52.027%	Swiss-Prot	strong database homology
`Q9C8V0`	Arabidopsis thaliana	Immune-associated nucleotide-binding protein 6	45.062%	Swiss-Prot	moderate database homology
`Q9C8V2`	Arabidopsis thaliana	Immune-associated nucleotide-binding protein 7	45.946%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card