LXL04_031793 | RubberDandelionOmics

Gene overview

LXL04_031793

Reference: OH-1004 Chr: Chr07 Coordinates: 11447525-11452132 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2325 bp · LXL04_031793|LXL04_031793|OH1004|cDNA

ATGGGGGACGAAGAGGTTATGGGCTCAGCAAGCCCTGCTCCGTCGGATCACAAGCGGAAGCTCGATGAATTGGATAGCGAACCGTTCGAGCAACAACCTGCTTCCGCCGAGGCCAATGGCAATTCACAGTCGCCCGACGGTGACGGTGACGGTGATGGTGAGGGAGAAGGAGACGGTGATGCTGCTTCTAACGAAGATCCAGACGTGAAACGACCTCGTCTAGAGGACAATTCAGACGGTTCTGAAGGTACAGAGAATGG...

CDS

Download CDS FASTA

2325 bp · LXL04_031793|LXL04_031793|OH1004|CDS

ATGGGGGACGAAGAGGTTATGGGCTCAGCAAGCCCTGCTCCGTCGGATCACAAGCGGAAGCTCGATGAATTGGATAGCGAACCGTTCGAGCAACAACCTGCTTCCGCCGAGGCCAATGGCAATTCACAGTCGCCCGACGGTGACGGTGACGGTGATGGTGAGGGAGAAGGAGACGGTGATGCTGCTTCTAACGAAGATCCAGACGTGAAACGACCTCGTCTAGAGGACAATTCAGACGGTTCTGAAGGTACAGAGAATGG...

Protein

Download Protein FASTA

774 aa · LXL04_031793|LXL04_031793|OH1004|PROTEIN

MGDEEVMGSASPAPSDHKRKLDELDSEPFEQQPASAEANGNSQSPDGDGDGDGEGEGDGDAASNEDPDVKRPRLEDNSDGSEGTENGHQEETVEEEKEDITEHSDSMKNTELEENAEKSDEPLDPVNQESLNDEPQANSVEPQAAENPIESPKEDNQEYGADYPDPTPDAGLQEDEYDLKEQSTSSDQLTSRRMEVPSNKVGVLIGKGGDTIRTLQYSSGARIQITRDSEADPDALTRNVELIGSLENINKAERLIKDVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031793`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_031793`
Location	Chr07:11447525-11452132 (-)
Description	Similar to FUBP1: Far upstream element-binding protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031793` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0010628 positive regulation of gene expression Biological Process GO:0048103 somatic stem cell division Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function GO:0003697 single-stranded DNA binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003730 mRNA 3'-UTR binding Molecular Function
KEGG gene cross-reference	hsa:8880 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.933

Rank 1 · LXL04_031793 · OH-1004

Cytoplasm0.232

Rank 2 · LXL04_031793 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_031793 · OH-1004

Endoplasmic reticulum0.019

Rank 4 · LXL04_031793 · OH-1004

Mitochondrion0.017

Rank 5 · LXL04_031793 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00013.36KH_1192-258 aa

PF13083.14KH_KhpA-B286-313 aa

PF07650.24KH_2287-321 aa

PF00013.36KH_1288-355 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031793	`PF00013.36`	KH_1	192	258	1.1e-34	118.7
LXL04_031793	`PF13083.14`	KH_KhpA-B	286	313	1.2e-09	38.6
LXL04_031793	`PF07650.24`	KH_2	287	321	1.8e-08	34.8
LXL04_031793	`PF00013.36`	KH_1	288	355	1.1e-34	118.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card