LXL04_031786 | RubberDandelionOmics

Gene overview

LXL04_031786

Reference: OH-1004 Chr: Chr07 Coordinates: 11337842-11339473 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1632 bp · LXL04_031786|LXL04_031786|OH1004|cDNA

ATGTCTGTTTCTCTACCTCTCGCTTACCAACACcaagatcaagaacataacacTGAGATCTTCACCTCGTGCTTAACTCAGTTCGGTGTTAACAACTTCTCAACTCACTCAAACTCCAACAACGATTCATCGGTTTATTACCAGCTTCTTAATTTCTCAATCCAAAATCTTAGATTTTCCGGATCCAATTTACCCAAACCAACCGTTATTGTGTTCCCGGAAACGAAACAACAGTTGGCTAAAACCGTCATCTGTGCCAG...

CDS

Download CDS FASTA

1632 bp · LXL04_031786|LXL04_031786|OH1004|CDS

ATGTCTGTTTCTCTACCTCTCGCTTACCAACACCAAGATCAAGAACATAACACTGAGATCTTCACCTCGTGCTTAACTCAGTTCGGTGTTAACAACTTCTCAACTCACTCAAACTCCAACAACGATTCATCGGTTTATTACCAGCTTCTTAATTTCTCAATCCAAAATCTTAGATTTTCCGGATCCAATTTACCCAAACCAACCGTTATTGTGTTCCCGGAAACGAAACAACAGTTGGCTAAAACCGTCATCTGTGCCAG...

Protein

Download Protein FASTA

543 aa · LXL04_031786|LXL04_031786|OH1004|PROTEIN

MSVSLPLAYQHQDQEHNTEIFTSCLTQFGVNNFSTHSNSNNDSSVYYQLLNFSIQNLRFSGSNLPKPTVIVFPETKQQLAKTVICARQSSLEIRVRCGGHSYEGTSSVAMDGRPFVVIDMTRLDHVSVDVNSNSAWVESGATLGQTYYAIAEASSVHGFSAGSCPTVGIGGHISGGGFGLLSRKYGLAADNVLDAILVTANGELLDRQAMGEDVFWAIRGGGGGVWGIVYAWKIQLSSVPKAVTSFIVSRPGTMKQVTDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031786`
TK1151 ID	TkA08G130160
OH-1004 ID	LXL04_031786
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_031786`
Location	Chr07:11337842-11339473 (+)
Description	Similar to BBE1: Reticuline oxidase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031786` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0009753 response to jasmonic acid Biological Process GO:0009820 alkaloid metabolic process Biological Process GO:0009821 alkaloid biosynthetic process Biological Process GO:0042179 nicotine biosynthetic process Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005773 vacuole Cellular Component GO:0016491 oxidoreductase activity Molecular Function GO:0071949 FAD binding Molecular Function
KEGG gene cross-reference	nta:107779537 nta:107791775 nta:107821171 nta:107830440 nta:107831580 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.303

Rank 1 · LXL04_031786 · OH-1004

Extracellular0.236

Rank 2 · LXL04_031786 · OH-1004

Endoplasmic reticulum0.210

Rank 3 · LXL04_031786 · OH-1004

Cytoplasm0.170

Rank 4 · LXL04_031786 · OH-1004

Cell membrane0.084

Rank 5 · LXL04_031786 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01565.29FAD_binding_467-205 aa

PF08031.18BBE461-527 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031786	`PF01565.29`	FAD_binding_4	67	205	2.5e-29	102.5
LXL04_031786	`PF08031.18`	BBE	461	527	1.6e-19	70.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card