LXL04_031778 | RubberDandelionOmics

Gene overview

LXL04_031778

Reference: OH-1004 Chr: Chr07 Coordinates: 11217591-11219891 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2301 bp · LXL04_031778|LXL04_031778|OH1004|cDNA

ATGAAACGAAGTTTCTTCCAGGATGCTTCTATTCAGAATTTCATCTTTAAACTCCATGAGGCTTCTAAAATGTTCAACGCCCACATCCTCTGCTCTCGCTCATTCACCTCCTCCGTCTCCGCTCACCGCAACTTCCAAGAACATTTCAGGGGTTTCCTCTCCAAAGGTTGTCTCGATGAAGCTCTCACTCTCTTCTACACTTCAAACACTCCTCATACCCAACAAACCTACGCCGATCTCTTCCACGCGTGTGCGCGCCA...

CDS

Download CDS FASTA

2301 bp · LXL04_031778|LXL04_031778|OH1004|CDS

ATGAAACGAAGTTTCTTCCAGGATGCTTCTATTCAGAATTTCATCTTTAAACTCCATGAGGCTTCTAAAATGTTCAACGCCCACATCCTCTGCTCTCGCTCATTCACCTCCTCCGTCTCCGCTCACCGCAACTTCCAAGAACATTTCAGGGGTTTCCTCTCCAAAGGTTGTCTCGATGAAGCTCTCACTCTCTTCTACACTTCAAACACTCCTCATACCCAACAAACCTACGCCGATCTCTTCCACGCGTGTGCGCGCCA...

Protein

Download Protein FASTA

766 aa · LXL04_031778|LXL04_031778|OH1004|PROTEIN

MKRSFFQDASIQNFIFKLHEASKMFNAHILCSRSFTSSVSAHRNFQEHFRGFLSKGCLDEALTLFYTSNTPHTQQTYADLFHACARHGNLSQGQRLHRHMLDTHNPNLSPNLYVTNHLINMYAKCGSMEYARKLFDEMGERNIVSWTALISGYAQSERRYESCEMFSKMLADYRPNEFSYASVLSSCDPEFGKQVHAHALKTCLDAYTYVANALITMYTNTYNKNDPKDTPFEAWNVFKFLKSRNLVTWNSMTAAFQSRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031778`
TK1151 ID	TkA08G129660
OH-1004 ID	LXL04_031778
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031778

Location Chr07:11217591-11219891 (+)

Description Similar to PCMP-H70: Pentatricopeptide repeat-containing protein At1g71420

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71420`	Pentatricopeptide repeat-containing protein At1g71420.	No verified direct reference in this release
`At2g27610`	Pentatricopeptide repeat-containing protein At2g27610.	No verified direct reference in this release
`At2g22070`	Pentatricopeptide repeat-containing protein At2g22070.	No verified direct reference in this release
`At3g22690`	Pentatricopeptide repeat-containing protein At3g22690.	No verified direct reference in this release
`At4g30700`	Pentatricopeptide repeat-containing protein At4g30700.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031778 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009451 RNA modification Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G71420

ath:AT2G22070

ath:AT2G27610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.634

Rank 1 · LXL04_031778 · OH-1004

Plastid0.231

Rank 2 · LXL04_031778 · OH-1004

Nucleus0.057

Rank 3 · LXL04_031778 · OH-1004

Cytoplasm0.036

Rank 4 · LXL04_031778 · OH-1004

Cell membrane0.006

Rank 5 · LXL04_031778 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041.13PPR_2110-143 aa

PF01535.27PPR116-143 aa

PF13041.13PPR_2141-187 aa

PF13041.13PPR_2358-406 aa

PF13041.13PPR_2458-503 aa

PF20431.5E_motif574-635 aa

PF14432.13DYW_deaminase671-766 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031778	`PF13041.13`	PPR_2	110	143	1.4e-38	131.5
LXL04_031778	`PF01535.27`	PPR	116	143	3.9e-46	152.8
LXL04_031778	`PF13041.13`	PPR_2	141	187	1.4e-38	131.5
LXL04_031778	`PF13041.13`	PPR_2	358	406	1.4e-38	131.5
LXL04_031778	`PF13041.13`	PPR_2	458	503	1.4e-38	131.5
LXL04_031778	`PF20431.5`	E_motif	574	635	8.8e-13	49.0
LXL04_031778	`PF14432.13`	DYW_deaminase	671	766	9.1e-34	115.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9H9`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At1g71420	49.866%	Swiss-Prot	moderate database homology
`Q9ZUW3`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At2g27610	35.471%	Swiss-Prot	moderate database homology
`Q9SHZ8`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At2g22070	33.554%	Swiss-Prot	moderate database homology
`Q9LUJ2`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At3g22690	33.773%	Swiss-Prot	moderate database homology
`Q9SUH6`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At4g30700	35.489%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card