LXL04_031777 | RubberDandelionOmics

Gene overview

LXL04_031777

Reference: OH-1004 Chr: Chr07 Coordinates: 11208622-11211560 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1791 bp · LXL04_031777|LXL04_031777|OH1004|cDNA

ATGTTCAAGAAATCGGTCGAAGCAAAAGCGCAGCAGCGATTATCAGGTGCAGACCGTAAGAAGTTGAAGCGAACAATCAAAGAACGCTTCCCAAATGCATCCGATACCGACCTCGACACTTTAATCCCTCCTAAGGTAGAGGTGACTGTCTCAAAGCACCCAAACCGTGTCCTTATTTACAGTTTAGAAGGTGGATTGCCAATTTTCTTTGATGTTGATAGCAGAGGCACAACCATATTTCCAACAGTCTATGCATTATG...

CDS

Download CDS FASTA

1791 bp · LXL04_031777|LXL04_031777|OH1004|CDS

ATGTTCAAGAAATCGGTCGAAGCAAAAGCGCAGCAGCGATTATCAGGTGCAGACCGTAAGAAGTTGAAGCGAACAATCAAAGAACGCTTCCCAAATGCATCCGATACCGACCTCGACACTTTAATCCCTCCTAAGGTAGAGGTGACTGTCTCAAAGCACCCAAACCGTGTCCTTATTTACAGTTTAGAAGGTGGATTGCCAATTTTCTTTGATGTTGATAGCAGAGGCACAACCATATTTCCAACAGTCTATGCATTATG...

Protein

Download Protein FASTA

596 aa · LXL04_031777|LXL04_031777|OH1004|PROTEIN

MFKKSVEAKAQQRLSGADRKKLKRTIKERFPNASDTDLDTLIPPKVEVTVSKHPNRVLIYSLEGGLPIFFDVDSRGTTIFPTVYALWKVPHLLPAFILKGGEVSRYMIGGADLMFPGISIDSEGLPEFLAGQPWAVKVPGNPAPFAVGSTCMSSSEALKAGLRGKALKITHHYRDALWESAEGRYVPNAGFLEDVVFGDPSFSTTDPSSDQENIIDNQELEASIDDLDANYPDSSSKVDPTQQVRTDLGDLKVTDNAESD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031777`
TK1151 ID	TkA08G129640
OH-1004 ID	LXL04_031777
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_031777`
Location	Chr07:11208622-11211560 (+)
Description	Similar to Eif2d: Eukaryotic translation initiation factor 2D
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031777` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0001731 formation of translation preinitiation complex Biological Process GO:0006886 intracellular protein transport Biological Process GO:0032790 ribosome disassembly Biological Process GO:0075522 IRES-dependent viral translational initiation Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0016604 nuclear body Cellular Component GO:0003723 RNA binding Molecular Function GO:0003743 translation initiation factor activity Molecular Function GO:0038023 signaling receptor activity Molecular Function
KEGG gene cross-reference	hsa:1939 mmu:16865 ocu:100345187 pon:100172724 rno:498225 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.627

Rank 1 · LXL04_031777 · OH-1004

Nucleus0.528

Rank 2 · LXL04_031777 · OH-1004

Mitochondrion0.038

Rank 3 · LXL04_031777 · OH-1004

Endoplasmic reticulum0.034

Rank 4 · LXL04_031777 · OH-1004

Cell membrane0.029

Rank 5 · LXL04_031777 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17832.8Pre-PUA2-90 aa

PF26292.1PUA_elF2D101-175 aa

PF25304.2WHD_eIF2D276-358 aa

PF26291.1SWIB_eIF2D400-460 aa

PF01253.28SUI1506-583 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031777	`PF17832.8`	Pre-PUA	2	90	3.5e-19	69.9
LXL04_031777	`PF26292.1`	PUA_elF2D	101	175	3.9e-22	78.6
LXL04_031777	`PF25304.2`	WHD_eIF2D	276	358	9e-28	97.0
LXL04_031777	`PF26291.1`	SWIB_eIF2D	400	460	2.1e-12	47.3
LXL04_031777	`PF01253.28`	SUI1	506	583	1.7e-22	80.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card