LXL04_031773 | RubberDandelionOmics

Gene overview

LXL04_031773

Reference: OH-1004 Chr: Chr07 Coordinates: 11128414-11134138 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3156 bp · LXL04_031773|LXL04_031773|OH1004|cDNA

ATGACCGTCAACATTCTTCCGTCGGAGATGATCGAAGCAATATTGGGGCGATTGCCGGCCAAATCTCTCTGCCGGTTCAAGTCCGTATCAAAACAATGGTGCTGGCTAATTTCCGATCCCCTATTCATCAAGAACCAACTCCGTCTCAATAACCATCACATACCCACTAAGCTGATTCTGCATTCATATGCAGGGCGTCTCTACTCTATTGATATCAACAAAATCAGCAACGACAGAGCAGTAACCGCGGAAGAATTAAT...

CDS

Download CDS FASTA

3156 bp · LXL04_031773|LXL04_031773|OH1004|CDS

ATGACCGTCAACATTCTTCCGTCGGAGATGATCGAAGCAATATTGGGGCGATTGCCGGCCAAATCTCTCTGCCGGTTCAAGTCCGTATCAAAACAATGGTGCTGGCTAATTTCCGATCCCCTATTCATCAAGAACCAACTCCGTCTCAATAACCATCACATACCCACTAAGCTGATTCTGCATTCATATGCAGGGCGTCTCTACTCTATTGATATCAACAAAATCAGCAACGACAGAGCAGTAACCGCGGAAGAATTAAT...

Protein

Download Protein FASTA

1051 aa · LXL04_031773|LXL04_031773|OH1004|PROTEIN

MTVNILPSEMIEAILGRLPAKSLCRFKSVSKQWCWLISDPLFIKNQLRLNNHHIPTKLILHSYAGRLYSIDINKISNDRAVTAEELIIWRPLSSWGEMLGSCDGLVLAIDKVDYVYLINPTIREVSKVPFVPLGHWYDGEDMLGFGYDSSIDSYKIILISLRWREKDSDFTKMMVLPNPPYKILSSSPFMGIFMNGNIHWLIKTPLIWLIIAFSLANEGFTEIKFPNLFDYEIDGCKKLFVIGGKLGFRTKSNDLWVMEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031773`
TK1151 ID	TkA08G129370
OH-1004 ID	LXL04_031773
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.500
Protein coverage (%)	TK1151 79.861 / OH-1004 10.942 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031773

Location Chr07:11128414-11134138 (-)

Description Similar to EX70I: Exocyst complex component EXO70I

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03540`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	AtEXO70A1, a member of a family of putative exocyst subunits specifically expanded in land plants, is important for polar growth and plant development.2006 · DOI: 10.1111/j.1365-313x.2006.02854.x Arabidopsis exocyst subunits SEC8 and EXO70A1 and exocyst interactor ROH1 are involved in the localized deposition of seed coat pectin.2010 · DOI: 10.1111/j.1469-8137.2010.03372.x The Arabidopsis exocyst complex is involved in cytokinesis and cell plate maturation.2010 · DOI: 10.1105/tpc.110.074351 The exocyst complex contributes to PIN auxin efflux carrier recycling and polar auxin transport in Arabidopsis.2013 · DOI: 10.1111/tpj.12074 EXO70A1-mediated vesicle trafficking is critical for tracheary element development in Arabidopsis.2013 · DOI: 10.1105/tpc.113.112144 Microtubule-dependent targeting of the exocyst complex is necessary for xylem development in Arabidopsis.2017 · DOI: 10.1111/nph.14267
`At5g52350`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	No verified direct reference in this release
`At5g58430`	Component of an exocyst subcomplex specifically involved in autophagy-related, Golgi-independent membrane traffic to the vacuole.	Arabidopsis exocyst subcomplex containing subunit EXO70B1 is involved in autophagy-related transport to the vacuole.2013 · DOI: 10.1111/tra.12101 The N-Terminal UND Motif of the Arabidopsis U-Box E3 Ligase PUB18 Is Critical for the Negative Regulation of ABA-Mediated Stomatal Movement and Determines Its Ubiquitination Specificity for Exocyst Subunit Exo70B1.2016 · DOI: 10.1105/tpc.16.00347
`At5g13990`	Required for optimal tip growth of pollen tube.	EXO70C2 Is a Key Regulatory Factor for Optimal Tip Growth of Pollen.2017 · DOI: 10.1104/pp.16.01282 Regulation of Exocyst Function in Pollen Tube Growth by Phosphorylation of Exocyst Subunit EXO70C2.2020 · DOI: 10.3389/fpls.2020.609600

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031773 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000919 cell plate assembly Biological Process

GO:0006887 exocytosis Biological Process

GO:0006952 defense response Biological Process

GO:0006955 immune response Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009609 response to symbiotic bacterium Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009630 gravitropism Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0010015 root morphogenesis Biological Process

KEGG gene cross-reference

ath:AT5G03540

ath:AT5G13990

ath:AT5G52350

ath:AT5G58430

mtr:11416358

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.459

Rank 1 · LXL04_031773 · OH-1004

Cell membrane0.350

Rank 2 · LXL04_031773 · OH-1004

Nucleus0.306

Rank 3 · LXL04_031773 · OH-1004

Endoplasmic reticulum0.053

Rank 4 · LXL04_031773 · OH-1004

Lysosome / Vacuole0.045

Rank 5 · LXL04_031773 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937.13F-box-like4-42 aa

PF00646.39F-box6-42 aa

PF07734.19FBA_166-272 aa

PF08268.18FBA_397-272 aa

PF03081.23Exo70_C643-996 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031773	`PF12937.13`	F-box-like	4	42	5.4e-07	30.0
LXL04_031773	`PF00646.39`	F-box	6	42	7.5e-07	29.5
LXL04_031773	`PF07734.19`	FBA_1	66	272	5.1e-09	36.3
LXL04_031773	`PF08268.18`	FBA_3	97	272	3e-07	30.5
LXL04_031773	`PF03081.23`	Exo70_C	643	996	5.7e-82	276.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZD3`	Arabidopsis thaliana	Exocyst complex component EXO70A1	25.980%	Swiss-Prot	weak database homology
`F4KG58`	Arabidopsis thaliana	Exocyst complex component EXO70A3	26.214%	Swiss-Prot	weak database homology
`Q9FGH9`	Arabidopsis thaliana	Exocyst complex component EXO70B1	26.794%	Swiss-Prot	weak database homology
`Q9FFX6`	Arabidopsis thaliana	Exocyst complex component EXO70C2	23.789%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card