LXL04_031729 | RubberDandelionOmics

Gene overview

LXL04_031729

Reference: OH-1004 Chr: Chr07 Coordinates: 10349156-10349620 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

465 bp · LXL04_031729|LXL04_031729|OH1004|cDNA

ATGGCAGCCGAAACAGATGTCAGTATTGCTGGGTATCTTGAGAAGCATGAAGCCGACGACACCACCCAAAAGCTGGAGAATATGAACATTTCCTTCAGCATTTGGCCGCCGTCGCAGCGAACTCGCGATGCTGTCACCAAAGGCCTTGTCGAAACCCTTTCCACCACTTCGATTCTCTCTAAACGCTATGGCAGTGTACCTACCGAAGAAGCCACCGCCATCGCCGAACGTATAGAGGACGAGGCCTTCGTTGCTGCCTC...

CDS

Download CDS FASTA

465 bp · LXL04_031729|LXL04_031729|OH1004|CDS

ATGGCAGCCGAAACAGATGTCAGTATTGCTGGGTATCTTGAGAAGCATGAAGCCGACGACACCACCCAAAAGCTGGAGAATATGAACATTTCCTTCAGCATTTGGCCGCCGTCGCAGCGAACTCGCGATGCTGTCACCAAAGGCCTTGTCGAAACCCTTTCCACCACTTCGATTCTCTCTAAACGCTATGGCAGTGTACCTACCGAAGAAGCCACCGCCATCGCCGAACGTATAGAGGACGAGGCCTTCGTTGCTGCCTC...

Protein

Download Protein FASTA

154 aa · LXL04_031729|LXL04_031729|OH1004|PROTEIN

MAAETDVSIAGYLEKHEADDTTQKLENMNISFSIWPPSQRTRDAVTKGLVETLSTTSILSKRYGSVPTEEATAIAERIEDEAFVAASASSGSPEDDGIEVLQAYSKEISKRMLDFMKSRSALAETSPSLEEDNRVTAATAADSTANDGGNSIEV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031729`
TK1151 ID	TkA08G126460
OH-1004 ID	LXL04_031729
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	58.500
Protein coverage (%)	TK1151 55.357 / OH-1004 41.558 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031729

Location Chr07:10349156-10349620 (+)

Description Similar to MAF1: MFP1 attachment factor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43070`	Regulates the mitotic activity in roots.	Arabidopsis WPP-domain proteins are developmentally associated with the nuclear envelope and promote cell division.2004 · DOI: 10.1105/tpc.104.026740 WPP-domain proteins mimic the activity of the HSC70-1 chaperone in preventing mistargeting of RanGAP1-anchoring protein WIT1.2009 · DOI: 10.1104/pp.109.143404
`At1g47200`	Regulates the mitotic activity in roots.	Arabidopsis WPP-domain proteins are developmentally associated with the nuclear envelope and promote cell division.2004 · DOI: 10.1105/tpc.104.026740 WPP-domain proteins mimic the activity of the HSC70-1 chaperone in preventing mistargeting of RanGAP1-anchoring protein WIT1.2009 · DOI: 10.1104/pp.109.143404
`At5g27940`	Regulates the mitotic activity in roots.	No verified direct reference in this release
`At3g63130`	GTPase activator for the nuclear Ras-related regulatory protein Ran, converting it to the putatively inactive GDP-bound state.	Plant RanGAPs are localized at the nuclear envelope in interphase and associated with microtubules in mitotic cells.2002 · DOI: 10.1046/j.1365-313x.2002.01324.x RanGAP1 is a continuous marker of the Arabidopsis cell division plane.2008 · DOI: 10.1073/pnas.0806157105

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031729 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0006606 protein import into nucleus Biological Process

GO:0048527 lateral root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005640 nuclear outer membrane Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005819 spindle Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009504 cell plate Cellular Component

KEGG gene cross-reference

ath:AT1G47200

ath:AT3G63130

ath:AT5G27940

ath:AT5G43070

sly:543586

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.603

Rank 1 · LXL04_031729 · OH-1004

Cytoplasm0.463

Rank 2 · LXL04_031729 · OH-1004

Cell membrane0.081

Rank 3 · LXL04_031729 · OH-1004

Endoplasmic reticulum0.047

Rank 4 · LXL04_031729 · OH-1004

Golgi apparatus0.024

Rank 5 · LXL04_031729 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13943.12WPP31-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031729	`PF13943.12`	WPP	31	124	3.3e-36	124.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMH6`	Arabidopsis thaliana	WPP domain-containing protein 1	57.273%	Swiss-Prot	moderate database homology
`Q9C500`	Arabidopsis thaliana	WPP domain-containing protein 2	54.808%	Swiss-Prot	moderate database homology
`Q0WQ91`	Arabidopsis thaliana	WPP domain-containing protein 3	43.810%	Swiss-Prot	moderate database homology
`Q9LE82`	Arabidopsis thaliana	RAN GTPase-activating protein 1	38.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card