LXL04_031668 | RubberDandelionOmics

Gene overview

LXL04_031668

Reference: OH-1004 Chr: Chr07 Coordinates: 9369136-9370104 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

969 bp · LXL04_031668|LXL04_031668|OH1004|cDNA

ATGGGATCAGTAAGCAGGGAGATACTGCACGACGTTCCGCCGTACATAAGAGTCTACAAAGATGGAACCATCGAGAGGCTCGTTGGCATTGACGTTGTTCCCGCCGCTTTCGACTCCGCCACCGGCGTCACCTCAAAAGACGTCTTAATCTCACCAGAAACCGGCGTCTCCGCCAGGCTCTACCGTCCAACTCTCACATCCGCCTCGGAAAAACTCCCTCTCCTCCTCTACTTCCACGGCGGAGCATTCTGCATCGCGAC...

CDS

Download CDS FASTA

969 bp · LXL04_031668|LXL04_031668|OH1004|CDS

ATGGGATCAGTAAGCAGGGAGATACTGCACGACGTTCCGCCGTACATAAGAGTCTACAAAGATGGAACCATCGAGAGGCTCGTTGGCATTGACGTTGTTCCCGCCGCTTTCGACTCCGCCACCGGCGTCACCTCAAAAGACGTCTTAATCTCACCAGAAACCGGCGTCTCCGCCAGGCTCTACCGTCCAACTCTCACATCCGCCTCGGAAAAACTCCCTCTCCTCCTCTACTTCCACGGCGGAGCATTCTGCATCGCGAC...

Protein

Download Protein FASTA

322 aa · LXL04_031668|LXL04_031668|OH1004|PROTEIN

MGSVSREILHDVPPYIRVYKDGTIERLVGIDVVPAAFDSATGVTSKDVLISPETGVSARLYRPTLTSASEKLPLLLYFHGGAFCIATPFEPKYHQSVINLVSEARVIAVSVDYRLAPEHPLPAAFDDSHAALRWVSSHAPGGTGTEEWIKENVDFDRIFLAGDSAGATIAHHMAIRIGSNPDPRIRKLSGIVLINPYFWGKEAIGSEKTDHVRKAMVDKWWEFVCPKDSHLGFDDPLINPFAEGAPDMLGLGCGRVMVTV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031668`
TK1151 ID	TkA08G121350
OH-1004 ID	LXL04_031668
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031668

Location Chr07:9369136-9370104 (-)

Description Similar to CXE2: Probable carboxylesterase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47480`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At3g48700`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At3g48690`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031668 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009717 isoflavonoid biosynthetic process Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0046287 isoflavonoid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016787 hydrolase activity Molecular Function

GO:0033987 2-hydroxyisoflavanone dehydratase activity Molecular Function

GO:0052689 carboxylic ester hydrolase activity Molecular Function

GO:0106435 carboxylesterase activity Molecular Function

KEGG gene cross-reference

ath:AT1G47480

ath:AT3G48690

ath:AT3G48700

gmx:547489

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.867

Rank 1 · LXL04_031668 · OH-1004

Nucleus0.338

Rank 2 · LXL04_031668 · OH-1004

Endoplasmic reticulum0.052

Rank 3 · LXL04_031668 · OH-1004

Cell membrane0.033

Rank 4 · LXL04_031668 · OH-1004

Mitochondrion0.030

Rank 5 · LXL04_031668 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00135.35COesterase61-174 aa

PF20434.6BD-FAE67-175 aa

PF07859.20Abhydrolase_375-299 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031668	`PF00135.35`	COesterase	61	174	1e-07	32.1
LXL04_031668	`PF20434.6`	BD-FAE	67	175	1.7e-12	48.1
LXL04_031668	`PF07859.20`	Abhydrolase_3	75	299	1.1e-53	182.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SX78`	Arabidopsis thaliana	Probable carboxylesterase 2	52.648%	Swiss-Prot	strong database homology
`Q9SMM9`	Arabidopsis thaliana	Probable carboxylesterase 13	45.988%	Swiss-Prot	moderate database homology
`Q9SMN0`	Arabidopsis thaliana	Probable carboxylesterase 12	45.768%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card