LXL04_031599 | RubberDandelionOmics

Gene overview

LXL04_031599

Reference: OH-1004 Chr: Chr07 Coordinates: 8155981-8156609 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

333 bp · LXL04_031599|LXL04_031599|OH1004|cDNA

ATGTTCACGGTAAAACGCAACGGAGACAGTGAGCACCTGAGCGATGTTAACAAGTTGGAAGGTATACCTTGTGTGAAGAAGGGAGGGATTAGGTTTACGGTGAACGGACACTCGTACTTCAATTTGGTGCTGATAACGAACGTGGGCGGAGCAGGGGACGTGAAAGCGGTTGCGATCAAAGGTTCTAGGACAGGGTGGGCGCCAATGTCGAGGAATTGGGGCCAGAATTGGCAGAGCAACTCGAATCTTGATGGGCAGGT...

CDS

Download CDS FASTA

333 bp · LXL04_031599|LXL04_031599|OH1004|CDS

ATGTTCACGGTAAAACGCAACGGAGACAGTGAGCACCTGAGCGATGTTAACAAGTTGGAAGGTATACCTTGTGTGAAGAAGGGAGGGATTAGGTTTACGGTGAACGGACACTCGTACTTCAATTTGGTGCTGATAACGAACGTGGGCGGAGCAGGGGACGTGAAAGCGGTTGCGATCAAAGGTTCTAGGACAGGGTGGGCGCCAATGTCGAGGAATTGGGGCCAGAATTGGCAGAGCAACTCGAATCTTGATGGGCAGGT...

Protein

Download Protein FASTA

110 aa · LXL04_031599|LXL04_031599|OH1004|PROTEIN

MFTVKRNGDSEHLSDVNKLEGIPCVKKGGIRFTVNGHSYFNLVLITNVGGAGDVKAVAIKGSRTGWAPMSRNWGQNWQSNSNLDGQVLSFKVTTSDDHTVICNNAVPGAE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031599`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031599

Location Chr07:8155981-8156609 (-)

Description Similar to EXPA4: Expansin-A4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69530`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At1g26770`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0477600`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	Regulation of expansin gene expression affects growth and development in transgenic rice plants.2003 · DOI: 10.1105/tpc.011965
`UniProt: A2Y5R6`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`Os01g0823100`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031599 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006949 syncytium formation Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0009831 plant-type cell wall modification involved in multidimensional cell growth Biological Process

GO:0010114 response to red light Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0071669 plant-type cell wall organization or biogenesis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G26770

ath:AT1G69530

dosa:Os01g0823100

dosa:Os05g0477600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.597

Rank 1 · LXL04_031599 · OH-1004

Cytoplasm0.234

Rank 2 · LXL04_031599 · OH-1004

Nucleus0.078

Rank 3 · LXL04_031599 · OH-1004

Lysosome / Vacuole0.055

Rank 4 · LXL04_031599 · OH-1004

Endoplasmic reticulum0.045

Rank 5 · LXL04_031599 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01357.28Expansin_C30-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031599	`PF01357.28`	Expansin_C	30	107	2.3e-32	111.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C554`	Arabidopsis thaliana	Expansin-A1	77.108%	Swiss-Prot	strong database homology
`Q9LDR9`	Arabidopsis thaliana	Expansin-A10	76.744%	Swiss-Prot	strong database homology
`Q0DHB7`	Oryza sativa subsp. japonica	Expansin-A4	78.409%	Swiss-Prot	strong database homology
`A2Y5R6`	Oryza sativa subsp. indica	Expansin-A4	78.409%	Swiss-Prot	strong database homology
`Q40636`	Oryza sativa subsp. japonica	Expansin-A2	76.744%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card