LXL04_031588 | RubberDandelionOmics

Gene overview

LXL04_031588

Reference: OH-1004 Chr: Chr07 Coordinates: 7988983-7990099 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

645 bp · LXL04_031588|LXL04_031588|OH1004|cDNA

ATGAAGGCGTCTTTCAAGGCAAAATACGACGCCGACAAAGCCACCCCCGCCTCGGCCATCACCCTCGCTTTTAACGCCGGCGATGTCAAACTCCGTGCTTCCATGACCGATGCTACTCTGGTCAACGGCCCTTGCTTAAACGGTTTAGCTCTAGCCGTGGATAAGCCTGGATCCTTCAGCATCGACTACAATGTCCCCAAACAGGACTTCAGATTCATGTTCATGAACACAATCAAAGTTTCAGACAAGCCATTAAACCT...

CDS

Download CDS FASTA

645 bp · LXL04_031588|LXL04_031588|OH1004|CDS

ATGAAGGCGTCTTTCAAGGCAAAATACGACGCCGACAAAGCCACCCCCGCCTCGGCCATCACCCTCGCTTTTAACGCCGGCGATGTCAAACTCCGTGCTTCCATGACCGATGCTACTCTGGTCAACGGCCCTTGCTTAAACGGTTTAGCTCTAGCCGTGGATAAGCCTGGATCCTTCAGCATCGACTACAATGTCCCCAAACAGGACTTCAGATTCATGTTCATGAACACAATCAAAGTTTCAGACAAGCCATTAAACCT...

Protein

Download Protein FASTA

214 aa · LXL04_031588|LXL04_031588|OH1004|PROTEIN

MKASFKAKYDADKATPASAITLAFNAGDVKLRASMTDATLVNGPCLNGLALAVDKPGSFSIDYNVPKQDFRFMFMNTIKVSDKPLNLVYSHSRGDQRTMLDGTLVIDSANKVSANHVLGSGNCKFKYTYVHGGLTTFEPSYDLAKDSWDFAVSRKVYSDHVLKAVYQTSNQNLALDWSTKSKMAGSYKVSALFNLEDGLKVPRLTAESTWDFEM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031588`
TK1151 ID	TkA08G115240
OH-1004 ID	LXL04_031588
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031588

Location Chr07:7988983-7990099 (-)

Description Similar to OEP24B: Outer envelope pore protein 24B, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42960`	High-conductance voltage-dependent solute channel with a slight selectivity for cations transporting triosephosphates, dicarboxylic acids, ATP, inorganic phosphate (Pi), sugars, and positively or negatively charged amino acids.	No verified direct reference in this release
`At1g45170`	High-conductance voltage-dependent solute channel with a slight selectivity for cations transporting triosephosphates, dicarboxylic acids, ATP, inorganic phosphate (Pi), sugars, and positively or negatively charged amino acids.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8ANR3`	High-conductance voltage-dependent solute channel with a slight selectivity for cations transporting triosephosphates, dicarboxylic acids, ATP, inorganic phosphate (Pi), sugars, and positively or negatively charged amino acids.	No verified direct reference in this release
`Os03g0855600`	High-conductance voltage-dependent solute channel with a slight selectivity for cations transporting triosephosphates, dicarboxylic acids, ATP, inorganic phosphate (Pi), sugars, and positively or negatively charged amino acids.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031588 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0034765 regulation of monoatomic ion transmembrane transport Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0034426 etioplast membrane Cellular Component

GO:0046930 pore complex Cellular Component

GO:0015288 porin activity Molecular Function

GO:0022843 voltage-gated monoatomic cation channel activity Molecular Function

KEGG gene cross-reference

ath:AT1G45170

ath:AT5G42960

dosa:Os03g0855600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.761

Rank 1 · LXL04_031588 · OH-1004

Mitochondrion0.213

Rank 2 · LXL04_031588 · OH-1004

Extracellular0.033

Rank 3 · LXL04_031588 · OH-1004

Cytoplasm0.032

Rank 4 · LXL04_031588 · OH-1004

Cell membrane0.014

Rank 5 · LXL04_031588 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28482.1OEP241-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031588	`PF28482.1`	OEP24	1	213	4.2e-103	344.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H0Y1`	Arabidopsis thaliana	Outer envelope pore protein 24B, chloroplastic	64.019%	Swiss-Prot	strong database homology
`Q1H5C9`	Arabidopsis thaliana	Outer envelope pore protein 24A, chloroplastic	61.682%	Swiss-Prot	strong database homology
`B8ANR3`	Oryza sativa subsp. indica	Outer envelope pore protein 24, chloroplastic	45.982%	Swiss-Prot	moderate database homology
`Q75IQ4`	Oryza sativa subsp. japonica	Outer envelope pore protein 24, chloroplastic	45.982%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card