LXL04_031586 | RubberDandelionOmics

Gene overview

LXL04_031586

Reference: OH-1004 Chr: Chr07 Coordinates: 7975943-7978815 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1194 bp · LXL04_031586|LXL04_031586|OH1004|cDNA

ATGGAAAGTGCCTTCGCGAGCGCTTCCGCGATCGGTGATCAACGCCAGAAGATTGAAGAATACAAGCATATTCTTTCCTCCGTAATCGCGTCCAACGACGTAGTACAAGCCAAAAAGTTCATTGATCACATTCTTTCCGACGATGTTCCGTTGGTAGTATCAAGGCAGCTGTTACAGACATTTGCACAAGAGTTGGGAAGGTTGGAGCCTGAGAATCAAAAGGATATCGCTCATTACACGCTCCATCAGATTCAGCCTCG...

CDS

Download CDS FASTA

1194 bp · LXL04_031586|LXL04_031586|OH1004|CDS

ATGGAAAGTGCCTTCGCGAGCGCTTCCGCGATCGGTGATCAACGCCAGAAGATTGAAGAATACAAGCATATTCTTTCCTCCGTAATCGCGTCCAACGACGTAGTACAAGCCAAAAAGTTCATTGATCACATTCTTTCCGACGATGTTCCGTTGGTAGTATCAAGGCAGCTGTTACAGACATTTGCACAAGAGTTGGGAAGGTTGGAGCCTGAGAATCAAAAGGATATCGCTCATTACACGCTCCATCAGATTCAGCCTCG...

Protein

Download Protein FASTA

397 aa · LXL04_031586|LXL04_031586|OH1004|PROTEIN

MESAFASASAIGDQRQKIEEYKHILSSVIASNDVVQAKKFIDHILSDDVPLVVSRQLLQTFAQELGRLEPENQKDIAHYTLHQIQPRVVSFEEQVLVIREKLAELYESEQLWSKAAQMLSGIDLDSGMRVIDDKFRLTKCVQIARLYLEDDDAVNAEAFINKASFLVSNSQHEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIEKRQIGDEVIDEDALEQALAAAVTCTILAAAGPQRSRVLATLYKDERCSRLTIY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031586`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031586

Location Chr07:7975943-7978815 (-)

Description Similar to CSN4: COP9 signalosome complex subunit 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42970`	Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses.	Arabidopsis cop8 and fus4 mutations define the same gene that encodes subunit 4 of the COP9 signalosome.1999 · DOI: 10.1105/tpc.11.10.1967

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031586 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000338 protein deneddylation Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0010100 negative regulation of photomorphogenesis Biological Process

GO:0010971 positive regulation of G2/M transition of mitotic cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008180 COP9 signalosome Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0032991 protein-containing complex Cellular Component

KEGG gene cross-reference

ath:AT5G42970

bta:540223

ddi:DDB_G0293844

rno:360915

ssc:100125960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.629

Rank 1 · LXL04_031586 · OH-1004

Nucleus0.593

Rank 2 · LXL04_031586 · OH-1004

Lysosome / Vacuole0.056

Rank 3 · LXL04_031586 · OH-1004

Endoplasmic reticulum0.054

Rank 4 · LXL04_031586 · OH-1004

Golgi apparatus0.053

Rank 5 · LXL04_031586 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22241.3PSMD12-CSN4_N14-207 aa

PF01399.34PCI288-362 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031586	`PF22241.3`	PSMD12-CSN4_N	14	207	8.5e-33	114.6
LXL04_031586	`PF01399.34`	PCI	288	362	8.3e-19	68.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L5U0`	Arabidopsis thaliana	COP9 signalosome complex subunit 4	84.887%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card