LXL04_031577 | RubberDandelionOmics

Gene overview

LXL04_031577

Reference: OH-1004 Chr: Chr07 Coordinates: 7817110-7819141 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

696 bp · LXL04_031577|LXL04_031577|OH1004|cDNA

ATGGAGCCAGCTAAGTCCGCGTTTAAGATAATCCTGGGATCGTCTTCCATTGCCCGTCGGAAAATATTAGCTGAAATGGGATACGAGTTCACACTCATGTCTGCAGATATAGATGAGAAAAGCATCCGAACTGAAAAGCCAGAAGAGTTGGTAATGGCTCTAGCAAAGGAAAAGGCTGATGCCATAGTTTCCAAGCTTCAAAAAAGTGATGATCAAAAGAAGGATGCGACACCAAGTATTCTTATAGCATCTGATACAGC...

CDS

Download CDS FASTA

696 bp · LXL04_031577|LXL04_031577|OH1004|CDS

ATGGAGCCAGCTAAGTCCGCGTTTAAGATAATCCTGGGATCGTCTTCCATTGCCCGTCGGAAAATATTAGCTGAAATGGGATACGAGTTCACACTCATGTCTGCAGATATAGATGAGAAAAGCATCCGAACTGAAAAGCCAGAAGAGTTGGTAATGGCTCTAGCAAAGGAAAAGGCTGATGCCATAGTTTCCAAGCTTCAAAAAAGTGATGATCAAAAGAAGGATGCGACACCAAGTATTCTTATAGCATCTGATACAGC...

Protein

Download Protein FASTA

231 aa · LXL04_031577|LXL04_031577|OH1004|PROTEIN

MEPAKSAFKIILGSSSIARRKILAEMGYEFTLMSADIDEKSIRTEKPEELVMALAKEKADAIVSKLQKSDDQKKDATPSILIASDTAEGKPKLHSGEDKDAQPTLLITCDQVVVYEGIVREKPLNEEEARQFIKDYSGKHAATLSSVFVTNLNTGFNKVDYDKAEIYFHEIPEDAVDKLIDEGLVLRVAGALIIEHPLIVPYVKKLIGTTDSVMGLPKALTEKLIKEAMEA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031577`
TK1151 ID	TkA08G114850
OH-1004 ID	LXL04_031577
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_031577`
Location	Chr07:7817110-7819141 (+)
Description	Similar to DDB_G0281937: 7-methyl-GTP pyrophosphatase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031577` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0009117 nucleotide metabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0036218 dTTP diphosphatase activity Molecular Function GO:0036221 UTP diphosphatase activity Molecular Function GO:0047429 nucleoside triphosphate diphosphatase activity Molecular Function
KEGG gene cross-reference	ank:AnaeK_1353 ddi:DDB_G0281937 ere:EUBREC_3290 hch:HCH_05331 stp:Strop_0851 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.756

Rank 1 · LXL04_031577 · OH-1004

Nucleus0.301

Rank 2 · LXL04_031577 · OH-1004

Cell membrane0.114

Rank 3 · LXL04_031577 · OH-1004

Mitochondrion0.088

Rank 4 · LXL04_031577 · OH-1004

Endoplasmic reticulum0.049

Rank 5 · LXL04_031577 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02545.20Maf9-227 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031577	`PF02545.20`	Maf	9	227	8.9e-42	143.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card