Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2928 bp · LXL04_031520|LXL04_031520|OH1004|cDNA
ATGGCTGAATCCTACGTCGATTATTTCATCGGTACCAAGGGACTTATTAAAGTCGAATTCGTCAGACTGATTCTCGAGTCATTACATACTCTTGGGTATAAAAAAAGTGTCGAATATCTCGAGGAAGAATCAGGCATTGCTCTTTCATCGTCTGAAGTTAAAGAATTCACCCAACATATTCTCAATGGTAATTGGGAAGAAAGCTTGAATTCACTGAAAAAAATACCCGCCATCGACGAATCTGCTGTTAAATCGTCGTC...
2928 bp · LXL04_031520|LXL04_031520|OH1004|CDS
ATGGCTGAATCCTACGTCGATTATTTCATCGGTACCAAGGGACTTATTAAAGTCGAATTCGTCAGACTGATTCTCGAGTCATTACATACTCTTGGGTATAAAAAAAGTGTCGAATATCTCGAGGAAGAATCAGGCATTGCTCTTTCATCGTCTGAAGTTAAAGAATTCACCCAACATATTCTCAATGGTAATTGGGAAGAAAGCTTGAATTCACTGAAAAAAATACCCGCCATCGACGAATCTGCTGTTAAATCGTCGTC...
Protein
Download Protein FASTA975 aa · LXL04_031520|LXL04_031520|OH1004|PROTEIN
MAESYVDYFIGTKGLIKVEFVRLILESLHTLGYKKSVEYLEEESGIALSSSEVKEFTQHILNGNWEESLNSLKKIPAIDESAVKSSSFIILEQKFFDLLNEDDVEKALRTLRKDISSLSINENQVRELSSFLLLSNQRPMNPKPRSEVLRDLKKLFPPKVMIPELRLLHLIHQALDYQHDSCPFHNSVHEDISLLIDHTCGKGLIPSHTSQILRHHYDEVWFLEFSHNGRFLATSSKDRYAYTWQVSLSGSVQFKHQLSG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_031520 |
|---|---|
| TK1151 ID | TkA08G111230 |
| OH-1004 ID | LXL04_031520 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 94.600 |
| Protein coverage (%) | TK1151 98.592 / OH-1004 30.359Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_031520 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:7045680-7055544 (-) | |||||||||
| Description | Similar to WDR26: WD repeat-containing protein 26 homolog | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006970 response to osmotic stress Biological Process GO:0009416 response to light stimulus Biological Process GO:0009646 response to absence of light Biological Process GO:0009723 response to ethylene Biological Process GO:0009733 response to auxin Biological Process GO:0009737 response to abscisic acid Biological Process GO:0010150 leaf senescence Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0000151 ubiquitin ligase complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT5G08560 ath:AT5G43920 mmu:226757 xtr:733878 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23627.3LisH_WDR2610-50 aaPF21889.2TPR1-like_2nd53-140 aaPF24807.2WD40_CDC20-Fz208-296 aaPF25460.2Beta-prop_Aladin208-291 aaPF25047.1Beta-prop_TEP1_2nd210-294 aaPF23381.2Beta-prop_IFT122_1st211-417 aaPF25173.2Beta-prop_WDR3_1st211-369 aaPF00400.39WD40211-244 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_031520 | PF23627.3 | LisH_WDR26 | 10 | 50 | 7.2e-14 | 51.6 |
| LXL04_031520 | PF21889.2 | TPR1-like_2nd | 53 | 140 | 2.5e-06 | 28.5 |
| LXL04_031520 | PF24807.2 | WD40_CDC20-Fz | 208 | 296 | 2.2e-30 | 106.7 |
| LXL04_031520 | PF25460.2 | Beta-prop_Aladin | 208 | 291 | 1.3e-14 | 54.8 |
| LXL04_031520 | PF25047.1 | Beta-prop_TEP1_2nd | 210 | 294 | 1.4e-19 | 71.0 |
| LXL04_031520 | PF23381.2 | Beta-prop_IFT122_1st | 211 | 417 | 5.7e-45 | 154.5 |
| LXL04_031520 | PF25173.2 | Beta-prop_WDR3_1st | 211 | 369 | 8.2e-37 | 127.4 |
| LXL04_031520 | PF00400.39 | WD40 | 211 | 244 | 1.1e-36 | 124.3 |
| LXL04_031520 | PF24814.2 | WD40_Prp19 | 211 | 337 | 3.3e-28 | 99.3 |
| LXL04_031520 | PF23393.3 | Beta-prop_WDR90_POC16_2nd | 211 | 281 | 6e-15 | 56.0 |
| LXL04_031520 | PF23409.2 | Beta-prop_EML | 211 | 375 | 1.4e-12 | 48.5 |
| LXL04_031520 | PF25175.2 | Beta-prop_WDR5 | 213 | 503 | 1.5e-51 | 176.2 |
| LXL04_031520 | PF23414.2 | Beta-prop_EML_2 | 214 | 277 | 5.7e-22 | 79.1 |
| LXL04_031520 | PF24782.3 | WD40_MABP1-WDR62_2nd | 214 | 380 | 3.6e-15 | 56.5 |
| LXL04_031520 | PF24817.2 | WD40_WDHD1_1st | 215 | 282 | 4.3e-24 | 85.9 |
| LXL04_031520 | PF25174.2 | Beta-prop_THOC3 | 216 | 419 | 5.7e-45 | 154.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.