LXL04_031500 | RubberDandelionOmics

Gene overview

LXL04_031500

Reference: OH-1004 Chr: Chr07 Coordinates: 6901609-6906168 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1317 bp · LXL04_031500|LXL04_031500|OH1004|cDNA

ATTTTACACAAGTGACATGAAGGTTTGCAAAGGTTTGCAAAGGAAGTTGATGCAATTGTGGCAAAATGCCTCACTGGAGGGCCAAAATCAGTGGAGAAGGCACAGATTGTCTTCATGCTTTGGGTGGAGTTGGAGGCTGTGGATGCGTTTCTGGATGCTATGGATAAAGCAATAAAAGCCAAAGTTGCTAAAGCTGTTGTTCCTGCCATAGATGTCCTGTTTCAAGCCTTGAGGGTTAACACTTTGAGCTTTGTCGTTGG...

CDS

Download CDS FASTA

1293 bp · LXL04_031500|LXL04_031500|OH1004|CDS

TTGCAAAGGTTTGCAAAGGAAGTTGATGCAATTGTGGCAAAATGCCTCACTGGAGGGCCAAAATCAGTGGAGAAGGCACAGATTGTCTTCATGCTTTGGGTGGAGTTGGAGGCTGTGGATGCGTTTCTGGATGCTATGGATAAAGCAATAAAAGCCAAAGTTGCTAAAGCTGTTGTTCCTGCCATAGATGTCCTGTTTCAAGCCTTGAGGGTTAACACTTTGAGCTTTGTCGTTGGATTGGTAAAGATGCTGTTAAATCC...

Protein

Download Protein FASTA

430 aa · LXL04_031500|LXL04_031500|OH1004|PROTEIN

MQRFAKEVDAIVAKCLTGGPKSVEKAQIVFMLWVELEAVDAFLDAMDKAIKAKVAKAVVPAIDVLFQALRVNTLSFVVGLVKMLLNPYCLKKTRDTMKKELEAKIVNVTASAKPTRKISKTRNHNRKLPLRLRVLALLKNPQPRYKLVDPVDILTPLEKTVFWNGVKATKWSERRDVAELTKLASTKRIAPGDISEECHTLKKLIIDSSLAVAVEAVQVLGNLAAGLRTNLSASSRFLLPYFFKKPTMTVAHTNTPQAMH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031500`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031500

Location Chr07:6901609-6906168 (-)

Description Similar to MOR1: Protein MOR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35630`	Microtubule-binding protein that is essential for cortical microtubules organization and function.	MOR1 is essential for organizing cortical microtubules in plants.2001 · DOI: 10.1038/35079128 Mutation or drug-dependent microtubule disruption causes radial swelling without altering parallel cellulose microfibril deposition in Arabidopsis root cells.2003 · DOI: 10.1105/tpc.011593 Genetic analysis of adventitious root formation with a novel series of temperature-sensitive mutants of Arabidopsis thaliana.2003 · DOI: 10.1242/dev.00794 Cellulose microfibril alignment recovers from DCB-induced disruption despite microtubule disorganization.2003 · DOI: 10.1046/j.1365-313x.2003.01906.x Aberrant cell plate formation in the Arabidopsis thaliana microtubule organization 1 mutant.2005 · DOI: 10.1093/pcp/pci068 MICROTUBULE ORGANIZATION 1 regulates structure and function of microtubule arrays during mitosis and cytokinesis in the Arabidopsis root.2006 · DOI: 10.1104/pp.105.069989 Hypersensitivity to cytoskeletal antagonists demonstrates microtubule-microfilament cross-talk in the control of root elongation in Arabidopsis thaliana.2006 · DOI: 10.1111/j.1469-8137.2006.01671.x MOR1, the Arabidopsis thaliana homologue of Xenopus MAP215, promotes rapid growth and shrinkage, and suppresses the pausing of microtubules in vivo.2008 · DOI: 10.1242/jcs.039065

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0816400`	Microtubule-associated protein that is essential for cortical microtubules organization and function.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031500 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000281 mitotic cytokinesis Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0007030 Golgi organization Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0009920 cell plate formation involved in plant-type cell wall biogenesis Biological Process

GO:0030951 establishment or maintenance of microtubule cytoskeleton polarity Biological Process

GO:0046785 microtubule polymerization Biological Process

GO:0051298 centrosome duplication Biological Process

GO:0000776 kinetochore Cellular Component

GO:0000922 spindle pole Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G35630

ddi:DDB_G0268616

dosa:Os01g0816400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.457

Rank 1 · LXL04_031500 · OH-1004

Nucleus0.260

Rank 2 · LXL04_031500 · OH-1004

Mitochondrion0.150

Rank 3 · LXL04_031500 · OH-1004

Endoplasmic reticulum0.091

Rank 4 · LXL04_031500 · OH-1004

Cell membrane0.071

Rank 5 · LXL04_031500 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94FN2`	Arabidopsis thaliana	Protein MOR1	51.079%	Swiss-Prot	strong database homology
`Q5N749`	Oryza sativa subsp. japonica	Protein MOR1	50.235%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card