LXL04_031473 | RubberDandelionOmics

Gene overview

LXL04_031473

Reference: OH-1004 Chr: Chr07 Coordinates: 6463657-6465904 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1542 bp · LXL04_031473|LXL04_031473|OH1004|cDNA

ATGCGCCGGCGAGCTGCCGACTACCGGCGCCGGGTTCGAAGGAGGATTCCAATTTGGATCTGGGTGTTTCTTGGATTGTTCACTGTTGCTGGATTTGTTCTAATCGTTCTTCAACACAATTATCAAGATCAAGATCGCGTTGAACAGCACGTATCGGACCGAAAAGCTAGAAATGTACAAGTTCCACACACCAAATTGAATCTAACAAAAGAGATATCAAGTGCCAATTCATATACCCGCCAACTGCTCGAGCAAATGAC...

CDS

Download CDS FASTA

1542 bp · LXL04_031473|LXL04_031473|OH1004|CDS

ATGCGCCGGCGAGCTGCCGACTACCGGCGCCGGGTTCGAAGGAGGATTCCAATTTGGATCTGGGTGTTTCTTGGATTGTTCACTGTTGCTGGATTTGTTCTAATCGTTCTTCAACACAATTATCAAGATCAAGATCGCGTTGAACAGCACGTATCGGACCGAAAAGCTAGAAATGTACAAGTTCCACACACCAAATTGAATCTAACAAAAGAGATATCAAGTGCCAATTCATATACCCGCCAACTGCTCGAGCAAATGAC...

Protein

Download Protein FASTA

513 aa · LXL04_031473|LXL04_031473|OH1004|PROTEIN

MRRRAADYRRRVRRRIPIWIWVFLGLFTVAGFVLIVLQHNYQDQDRVEQHVSDRKARNVQVPHTKLNLTKEISSANSYTRQLLEQMTLAKAYVVLAKEHNNLHLAWQLSSKIRSCQSLLSKAAMNQEPIIEEEAQPLITTLSSLILKSQDHHYDIATTMMTMKSHIQALEERANAATVQAAFFGQLAAESVPKNLHCVNVKLLADWLTKKTIRDLVEEKKNSPRLLDNNLYHFCLFSDNLLAVNAVVNSTVSNTDHPKQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031473`
TK1151 ID	TkA08G108730
OH-1004 ID	LXL04_031473
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031473

Location Chr07:6463657-6465904 (+)

Description Similar to GAUT11: Probable galacturonosyltransferase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18580`	Glycosyltransferase involved in pectin and/or xylans biosynthesis in cell walls (By similarity).	Identification of Key Enzymes for Pectin Synthesis in Seed Mucilage.2018 · DOI: 10.1104/pp.18.00584
`At2g20810`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At5g47780`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At3g61130`	Involved in pectin biosynthesis.	Functional identification of an Arabidopsis pectin biosynthetic homogalacturonan galacturonosyltransferase.2006 · DOI: 10.1073/pnas.0600120103
`At4g38270`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031473 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010192 mucilage biosynthetic process Biological Process

GO:0010246 rhamnogalacturonan I biosynthetic process Biological Process

GO:0010289 homogalacturonan biosynthetic process Biological Process

GO:0010442 guard cell morphogenesis Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0048358 mucilage pectin biosynthetic process Biological Process

GO:0052546 cell wall pectin metabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0080001 mucilage extrusion from seed coat Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

KEGG gene cross-reference

ath:AT1G18580

ath:AT2G20810

ath:AT3G61130

ath:AT4G38270

ath:AT5G47780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.737

Rank 1 · LXL04_031473 · OH-1004

Endoplasmic reticulum0.151

Rank 2 · LXL04_031473 · OH-1004

Cytoplasm0.106

Rank 3 · LXL04_031473 · OH-1004

Cell membrane0.066

Rank 4 · LXL04_031473 · OH-1004

Extracellular0.061

Rank 5 · LXL04_031473 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25557.3GAUT_176-127 aa

PF01501.27Glyco_transf_8234-486 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031473	`PF25557.3`	GAUT_1	76	127	4.8e-07	30.6
LXL04_031473	`PF01501.27`	Glyco_transf_8	234	486	2.5e-60	204.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q949Q1`	Arabidopsis thaliana	Hexosyltransferase GAUT11	65.922%	Swiss-Prot	strong database homology
`Q9SKT6`	Arabidopsis thaliana	Probable galacturonosyltransferase 10	48.519%	Swiss-Prot	moderate database homology
`Q93ZX7`	Arabidopsis thaliana	Probable galacturonosyltransferase 4	42.004%	Swiss-Prot	moderate database homology
`Q9LE59`	Arabidopsis thaliana	Polygalacturonate 4-alpha-galacturonosyltransferase	41.239%	Swiss-Prot	moderate database homology
`Q0WQD2`	Arabidopsis thaliana	Probable galacturonosyltransferase 3	41.525%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card