LXL04_031457 | RubberDandelionOmics

Gene overview

LXL04_031457

Reference: OH-1004 Chr: Chr07 Coordinates: 6229777-6231056 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

918 bp · LXL04_031457|LXL04_031457|OH1004|cDNA

ATGTTTGGAATCAAGAAACCTCATTTCCACAGACCTACAAAACACAACTCAGTTGACCCAGGATTCCCCGGTCAACACACCTCAAACCCATTCGATTCCGATGATGAAATCGACAAAAAGTCAACCCCAATCCCAAATCCCGCAAGAAGAACTTCATCTGAACCTTCTGTACTGACCCAAGATTCCCGATCTGCCCTTTTTGATGACGATAATGAATCCAAAGGATCCGGATACAAACTCAGTTATGCATCAAGAAACAA...

CDS

Download CDS FASTA

918 bp · LXL04_031457|LXL04_031457|OH1004|CDS

ATGTTTGGAATCAAGAAACCTCATTTCCACAGACCTACAAAACACAACTCAGTTGACCCAGGATTCCCCGGTCAACACACCTCAAACCCATTCGATTCCGATGATGAAATCGACAAAAAGTCAACCCCAATCCCAAATCCCGCAAGAAGAACTTCATCTGAACCTTCTGTACTGACCCAAGATTCCCGATCTGCCCTTTTTGATGACGATAATGAATCCAAAGGATCCGGATACAAACTCAGTTATGCATCAAGAAACAA...

Protein

Download Protein FASTA

305 aa · LXL04_031457|LXL04_031457|OH1004|PROTEIN

MFGIKKPHFHRPTKHNSVDPGFPGQHTSNPFDSDDEIDKKSTPIPNPARRTSSEPSVLTQDSRSALFDDDNESKGSGYKLSYASRNKYKNDFVESGGVENQDVQELEHYAAYKAEETTKTVNSALKIAENIREDATKTIITLHQQGEQITRTHMTAADIEQDLSRGEKLLGSLGGIFSRTWKPKKGHAIKGPEMTRDDPAFRKGAHLEQREKLGLTSNVSKGQSHSRTSSEPTNAMQKVEYEITKQDDALSDLSNILGEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031457`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031457

Location Chr07:6229777-6231056 (-)

Description Similar to SNAP33: SNAP25 homologous protein SNAP33

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61210`	t-SNARE involved in diverse vesicle trafficking and membrane fusion processes, including cell plate formation.	No verified direct reference in this release
`At1g13890`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release
`At5g07880`	SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0437200`	t-SNARE involved in diverse vesicle trafficking and membrane fusion processes (Probable).	OsSYP121 Accumulates at Fungal Penetration Sites and Mediates Host Resistance to Rice Blast.2019 · DOI: 10.1104/pp.18.01013

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031457 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0006887 exocytosis Biological Process

GO:0006906 vesicle fusion Biological Process

GO:0006952 defense response Biological Process

GO:0009612 response to mechanical stimulus Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0016197 endosomal transport Biological Process

GO:0031340 positive regulation of vesicle fusion Biological Process

GO:0035493 SNARE complex assembly Biological Process

GO:0046887 positive regulation of hormone secretion Biological Process

GO:0051707 response to other organism Biological Process

KEGG gene cross-reference

ath:AT1G13890

ath:AT5G07880

ath:AT5G61210

dosa:Os02g0437200

osa:4329226

rno:25012

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.509

Rank 1 · LXL04_031457 · OH-1004

Cell membrane0.304

Rank 2 · LXL04_031457 · OH-1004

Nucleus0.200

Rank 3 · LXL04_031457 · OH-1004

Golgi apparatus0.106

Rank 4 · LXL04_031457 · OH-1004

Lysosome / Vacuole0.089

Rank 5 · LXL04_031457 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05739.27SNARE242-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031457	`PF05739.27`	SNARE	242	301	1.8e-10	41.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7P9`	Arabidopsis thaliana	SNAP25 homologous protein SNAP33	59.032%	Swiss-Prot	strong database homology
`Q9LMG8`	Arabidopsis thaliana	Putative SNAP25 homologous protein SNAP30	59.073%	Swiss-Prot	strong database homology
`Q9SD96`	Arabidopsis thaliana	SNAP25 homologous protein SNAP29	56.164%	Swiss-Prot	strong database homology
`Q0E1I7`	Oryza sativa subsp. japonica	SNAP25 homologous protein SNAP32	58.007%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card