LXL04_031412 | RubberDandelionOmics

Gene overview

LXL04_031412

Reference: OH-1004 Chr: Chr07 Coordinates: 5512357-5513682 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1326 bp · LXL04_031412|LXL04_031412|OH1004|cDNA

ATGATCAGGAAGAAATTGGAAACAGTCCCTTCTTCTTTGACCCAAATTAAGCTGATTCAAGAAGATCTCGATGCTAAAATCAAACCTCAGTTATGGGATCCCAAAACTATGCTGAGTAATCTCTCCATCATGGAAGAAAAAGTTCATCAACTCCAGGAATTAGTGCAATTAATTGTTTCCAAATCATCCATCAACCAATCAAATGAATTTTTGATCCAACAGCAACAACTTGTTACTGCAGATCTGACTTCAATTATAAT...

CDS

Download CDS FASTA

1326 bp · LXL04_031412|LXL04_031412|OH1004|CDS

ATGATCAGGAAGAAATTGGAAACAGTCCCTTCTTCTTTGACCCAAATTAAGCTGATTCAAGAAGATCTCGATGCTAAAATCAAACCTCAGTTATGGGATCCCAAAACTATGCTGAGTAATCTCTCCATCATGGAAGAAAAAGTTCATCAACTCCAGGAATTAGTGCAATTAATTGTTTCCAAATCATCCATCAACCAATCAAATGAATTTTTGATCCAACAGCAACAACTTGTTACTGCAGATCTGACTTCAATTATAAT...

Protein

Download Protein FASTA

441 aa · LXL04_031412|LXL04_031412|OH1004|PROTEIN

MIRKKLETVPSSLTQIKLIQEDLDAKIKPQLWDPKTMLSNLSIMEEKVHQLQELVQLIVSKSSINQSNEFLIQQQQLVTADLTSIIIQLISTAGSLLPNVKHPHFSPNPNPNPNTSDDNNSSDGNTHTTHKNKVSKIEDHSNETDHMDVHEEHDDDVDEGENLPPGSYEILQLEKDEILAPHTHFCVICGKGFKRDANLRMHMRGHGDEYKTAAALAKPHKDQGSEVKLIKRYSCPYIGCKRNKDHKKFQPLKTILCVKN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031412`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031412

Location Chr07:5512357-5513682 (+)

Description Similar to STOP1: Protein SENSITIVE TO PROTON RHIZOTOXICITY 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34370`	Probable transcription factor.	Zinc finger protein STOP1 is critical for proton tolerance in Arabidopsis and coregulates a key gene in aluminum tolerance.2007 · DOI: 10.1073/pnas.0700117104 Aluminum-activated citrate and malate transporters from the MATE and ALMT families function independently to confer Arabidopsis aluminum tolerance.2009 · DOI: 10.1111/j.1365-313x.2008.03696.x STOP1 regulates multiple genes that protect arabidopsis from proton and aluminum toxicities.2009 · DOI: 10.1104/pp.108.134700 STOP2 activates transcription of several genes for Al- and low pH-tolerance that are regulated by STOP1 in Arabidopsis.2014 · DOI: 10.1093/mp/sst116
`At5g22890`	Probable transcription factor.	STOP2 activates transcription of several genes for Al- and low pH-tolerance that are regulated by STOP1 in Arabidopsis.2014 · DOI: 10.1093/mp/sst116
`At1g51220`	Probable transcriptional regulator.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0871200`	Probable transcription factor that may be involved in aluminum tolerance.	No verified direct reference in this release
`Os12g0170400`	Transcriptional activator that regulates the expression of genes involved in aluminum (Al) tolerance.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031412 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010044 response to aluminum ion Biological Process

GO:0010447 response to acidic pH Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0071453 cellular response to oxygen levels Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:0080022 primary root development Biological Process

GO:1900037 regulation of cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G34370

ath:AT1G51220

ath:AT5G22890

dosa:Os01g0871200

dosa:Os12g0170400

osa:4324940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.977

Rank 1 · LXL04_031412 · OH-1004

Cytoplasm0.087

Rank 2 · LXL04_031412 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_031412 · OH-1004

Endoplasmic reticulum0.015

Rank 4 · LXL04_031412 · OH-1004

Plastid0.010

Rank 5 · LXL04_031412 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23115.2zf-C2H2_STOP2_3rd233-267 aa

PF23118.3zf-C2H2_STOP2_C298-327 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031412	`PF23115.2`	zf-C2H2_STOP2_3rd	233	267	4.6e-19	68.9
LXL04_031412	`PF23118.3`	zf-C2H2_STOP2_C	298	327	4.4e-20	71.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8N5`	Arabidopsis thaliana	Protein SENSITIVE TO PROTON RHIZOTOXICITY 1	57.303%	Swiss-Prot	strong database homology
`Q0WT24`	Arabidopsis thaliana	Protein SENSITIVE TO PROTON RHIZOTOXICITY 2	44.409%	Swiss-Prot	moderate database homology
`Q8W031`	Arabidopsis thaliana	Zinc finger protein WIP5	36.416%	Swiss-Prot	weak database homology
`Q943I6`	Oryza sativa subsp. japonica	Zinc finger protein STOP1 homolog	50.316%	Swiss-Prot	strong database homology
`Q2QX40`	Oryza sativa subsp. japonica	Zinc finger protein STAR3	51.703%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card