LXL04_031399 | RubberDandelionOmics

Gene overview

LXL04_031399

Reference: OH-1004 Chr: Chr07 Coordinates: 5409518-5410622 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

651 bp · LXL04_031399|LXL04_031399|OH1004|cDNA

ATGGCGACGAGGTGGAGCTGGAGAGCGATTGTGGTTTTCGTATGGTGGTGCGCTATCACTAGCACAACGCAAGCTATCTGGTTAGACTTACCCACTTCAGGAACCAAGTGTGTATCTGAAGATATTCAAAACAACGTCGTTGTTCTCGCCGATTTCTCCCTCATCAATGGTCAAGAGGACGCGCATATGGCCTCCGGCGCCACAATTTCTGTTCGGGTAACCTCGCCATACGGAAACAATCTGTACCACAAAGAGAACAT...

CDS

Download CDS FASTA

651 bp · LXL04_031399|LXL04_031399|OH1004|CDS

ATGGCGACGAGGTGGAGCTGGAGAGCGATTGTGGTTTTCGTATGGTGGTGCGCTATCACTAGCACAACGCAAGCTATCTGGTTAGACTTACCCACTTCAGGAACCAAGTGTGTATCTGAAGATATTCAAAACAACGTCGTTGTTCTCGCCGATTTCTCCCTCATCAATGGTCAAGAGGACGCGCATATGGCCTCCGGCGCCACAATTTCTGTTCGGGTAACCTCGCCATACGGAAACAATCTGTACCACAAAGAGAACAT...

Protein

Download Protein FASTA

216 aa · LXL04_031399|LXL04_031399|OH1004|PROTEIN

MATRWSWRAIVVFVWWCAITSTTQAIWLDLPTSGTKCVSEDIQNNVVVLADFSLINGQEDAHMASGATISVRVTSPYGNNLYHKENMTHGQFAFTTSESGNYLACFWVDGHHQGTKGLTVSLDWRIGIAAKDWESVAKKEKIEGVEFELRKLEGAVEAIHENLIYLKNKEAEMREVSEKTNARVAWFSIMSLGVCIGVSGLQLWYLKRFFHKKKLI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031399`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031399

Location Chr07:5409518-5410622 (-)

Description Similar to At1g09580: Transmembrane emp24 domain-containing protein p24delta3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09580`	Involved in vesicular protein trafficking.	No verified direct reference in this release
`At1g21900`	Involved in vesicular protein trafficking.	No verified direct reference in this release
`At1g57620`	Involved in vesicular protein trafficking.	No verified direct reference in this release
`At3g10780`	Involved in vesicular protein trafficking.	No verified direct reference in this release
`At1g26690`	Involved in vesicular protein trafficking.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031399 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0007030 Golgi organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005793 endoplasmic reticulum-Golgi intermediate compartment Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005801 cis-Golgi network Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0030134 COPII-coated ER to Golgi transport vesicle Cellular Component

KEGG gene cross-reference

ath:AT1G09580

ath:AT1G21900

ath:AT1G26690

ath:AT1G57620

ath:AT3G10780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.575

Rank 1 · LXL04_031399 · OH-1004

Golgi apparatus0.550

Rank 2 · LXL04_031399 · OH-1004

Cytoplasm0.089

Rank 3 · LXL04_031399 · OH-1004

Cell membrane0.047

Rank 4 · LXL04_031399 · OH-1004

Nucleus0.043

Rank 5 · LXL04_031399 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01105.30EMP24_GP25L25-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031399	`PF01105.30`	EMP24_GP25L	25	210	1.9e-51	175.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6IDL4`	Arabidopsis thaliana	Transmembrane emp24 domain-containing protein p24delta3	69.430%	Swiss-Prot	strong database homology
`Q8RWM6`	Arabidopsis thaliana	Transmembrane emp24 domain-containing protein p24delta5	65.464%	Swiss-Prot	strong database homology
`Q9FVU0`	Arabidopsis thaliana	Transmembrane emp24 domain-containing protein p24delta4	62.312%	Swiss-Prot	strong database homology
`F4J4Y0`	Arabidopsis thaliana	Transmembrane emp24 domain-containing protein p24delta6	55.838%	Swiss-Prot	strong database homology
`Q9LQY3`	Arabidopsis thaliana	Transmembrane emp24 domain-containing protein p24delta9	41.627%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card