Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2322 bp · LXL04_031380|LXL04_031380|OH1004|cDNA
ATGGCTGTTCATCATTTGGTGATCTTCTGTTCTTTCACTTTGCTTCAATTTCTCATCAATCCAGCACTTTCACTTCCTCTATGCACCGATTCAAGAGCACCATTGACACCAAAGAGTCCTCTGGCTTTCTGTTCTTATAACGAGTCTTCATGCTGCAATTCAACTCAAGATTCGAACATACAAAAGCAGTTTGAATCTTTGAATGTATCTCAGCCAGAATGTGCTTCTCTTCTCAAATCCATTCTTTGTGCGCAATGCGA...
2322 bp · LXL04_031380|LXL04_031380|OH1004|CDS
ATGGCTGTTCATCATTTGGTGATCTTCTGTTCTTTCACTTTGCTTCAATTTCTCATCAATCCAGCACTTTCACTTCCTCTATGCACCGATTCAAGAGCACCATTGACACCAAAGAGTCCTCTGGCTTTCTGTTCTTATAACGAGTCTTCATGCTGCAATTCAACTCAAGATTCGAACATACAAAAGCAGTTTGAATCTTTGAATGTATCTCAGCCAGAATGTGCTTCTCTTCTCAAATCCATTCTTTGTGCGCAATGCGA...
Protein
Download Protein FASTA773 aa · LXL04_031380|LXL04_031380|OH1004|PROTEIN
MAVHHLVIFCSFTLLQFLINPALSLPLCTDSRAPLTPKSPLAFCSYNESSCCNSTQDSNIQKQFESLNVSQPECASLLKSILCAQCDPFSAELYTITTSPRQAPVLCNSTVSPDSSQSNQAMTNFCETVYDSCQNVSIKNSPFSPLLQTPLTNTTSTLNQTWPSKTAFCTASGGSSTSGSVCFSGEKVTFNTTTNTTKNTPKGMCLERIGNDTYIDMVAHTDGSNRVFFANQKGQIWLATVPEMGSGGTLNIDESNPYLD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_031380 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_031380 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:5231504-5236909 (+) | |||||||||
| Description | Similar to HIPL1: HIPL1 protein | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0005576 extracellular region Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009536 plastid Cellular Component GO:0016020 membrane Cellular Component GO:0098552 side of membrane Cellular Component GO:0016491 oxidoreductase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G74790 ath:AT5G62630 hsa:79802 hsa:84439 mmu:78772 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07995.18GSDH257-491 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_031380 | PF07995.18 | GSDH | 257 | 491 | 1.6e-21 | 77.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.