LXL04_031371 | RubberDandelionOmics

Gene overview

LXL04_031371

Reference: OH-1004 Chr: Chr07 Coordinates: 5052365-5054277 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

927 bp · LXL04_031371|LXL04_031371|OH1004|cDNA

ATGGCAGCTCGAAGCTTTCTTTACGGTGGTGCTTCCGGTGGCGATGTCGGCGGTGGCGGCTCTGTTTTGCTGACAAACAAAAGGGTTCATTGTTCTTCTTCTCTTAACCCTGTTGATTCCTTCTTCGTCTCTCAATCGGCTTCTTTCCAGGGTTCTCGTTCAATACTTAGCTTTGAAGATAGAGGGAAGGGATCCGTGGGCCAAATTTTCCAGCCATTTGATCATGACGACAACGGAGATGATGAATACGATGAATACTT...

CDS

Download CDS FASTA

927 bp · LXL04_031371|LXL04_031371|OH1004|CDS

ATGGCAGCTCGAAGCTTTCTTTACGGTGGTGCTTCCGGTGGCGATGTCGGCGGTGGCGGCTCTGTTTTGCTGACAAACAAAAGGGTTCATTGTTCTTCTTCTCTTAACCCTGTTGATTCCTTCTTCGTCTCTCAATCGGCTTCTTTCCAGGGTTCTCGTTCAATACTTAGCTTTGAAGATAGAGGGAAGGGATCCGTGGGCCAAATTTTCCAGCCATTTGATCATGACGACAACGGAGATGATGAATACGATGAATACTT...

Protein

Download Protein FASTA

308 aa · LXL04_031371|LXL04_031371|OH1004|PROTEIN

MAARSFLYGGASGGDVGGGGSVLLTNKRVHCSSSLNPVDSFFVSQSASFQGSRSILSFEDRGKGSVGQIFQPFDHDDNGDDEYDEYFHQPEKKRRLTADQVRFLEKSFESDNKLEPERKIQLAKELGLQPRQVAIWFQNRRARWKTKQLEKDYDDLQESYNKLKANFENLVKEKEKLKSEVDELSDKLMIQEKGTSDSSSTKSPSEPQLCQPIPDCGYEEDLSKNMDPAYKPEGNLDVVFEGGDSSYIFEQEQSDVSLDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031371`
TK1151 ID	TkA08G103460
OH-1004 ID	LXL04_031371
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031371

Location Chr07:5052365-5054277 (+)

Description Similar to HAT5: Homeobox-leucine zipper protein HAT5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01470`	Probable transcription activator involved in leaf development.	Ectopic expression of the Arabidopsis transcriptional activator Athb-1 alters leaf cell fate in tobacco.1995 · DOI: 10.1105/tpc.7.11.1773

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0416000`	Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'.	No verified direct reference in this release
`UniProt: Q9XH36`	Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'.	No verified direct reference in this release
`Os02g0729700`	Probable transcription factor.	No verified direct reference in this release
`UniProt: A2X980`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031371 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009637 response to blue light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G01470

dosa:Os02g0729700

dosa:Os08g0416000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.979

Rank 1 · LXL04_031371 · OH-1004

Cytoplasm0.086

Rank 2 · LXL04_031371 · OH-1004

Cell membrane0.022

Rank 3 · LXL04_031371 · OH-1004

Endoplasmic reticulum0.014

Rank 4 · LXL04_031371 · OH-1004

Plastid0.012

Rank 5 · LXL04_031371 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046.36Homeodomain92-145 aa

PF02183.24HALZ147-188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031371	`PF00046.36`	Homeodomain	92	145	5e-18	65.4
LXL04_031371	`PF02183.24`	HALZ	147	188	6.3e-14	52.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q02283`	Arabidopsis thaliana	Homeobox-leucine zipper protein HAT5	56.115%	Swiss-Prot	weak database homology
`Q6ZA74`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein HOX5	56.098%	Swiss-Prot	weak database homology
`Q9XH36`	Oryza sativa subsp. indica	Homeobox-leucine zipper protein HOX5	56.098%	Swiss-Prot	weak database homology
`Q6YWR4`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein HOX16	45.930%	Swiss-Prot	moderate database homology
`A2X980`	Oryza sativa subsp. indica	Homeobox-leucine zipper protein HOX16	45.930%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card