LXL04_031365 | RubberDandelionOmics

Gene overview

LXL04_031365

Reference: OH-1004 Chr: Chr07 Coordinates: 5015587-5020006 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1772 bp · LXL04_031365|LXL04_031365|OH1004|cDNA

ACTGTACACTTTCCAAAACCCTCTCTCTTCCTCCTACAAATCACTCTCTCTCACTCGAGTTTCCACAAACACATCCTCAACTCAAGTCAAAGAGAAAAATCAAAATGTCTCTACTTCGACTCTCCAAAGGAATCAAGCAAACTGTTTCAAGTAAAGCAGCTTCAGATTATCTTTCTTCACTCAGATTCTCGAGACTCATTCATTCACTGGGATTTGCAACCGTGAAAGCGGAAGAGATTTCTGGGTCTAAACCTGCTGAA...

CDS

Download CDS FASTA

1668 bp · LXL04_031365|LXL04_031365|OH1004|CDS

ATGTCTCTACTTCGACTCTCCAAAGGAATCAAGCAAACTGTTTCAAGTAAAGCAGCTTCAGATTATCTTTCTTCACTCAGATTCTCGAGACTCATTCATTCACTGGGATTTGCAACCGTGAAAGCGGAAGAGATTTCTGGGTCTAAACCTGCTGAAGTACAAAACTTAGTCCAGGGAAAATGGATTAAACCTGCCAATTGGAATACAATTGTGGATCCTTTAAATGGAGAATCATTTATCAAAGTTTCAGAAGTAGATGA...

Protein

Download Protein FASTA

555 aa · LXL04_031365|LXL04_031365|OH1004|PROTEIN

MSLLRLSKGIKQTVSSKAASDYLSSLRFSRLIHSLGFATVKAEEISGSKPAEVQNLVQGKWIKPANWNTIVDPLNGESFIKVSEVDESGIQPFVESLSKCPKHGMHNPFKSPERYLMYGDISAKAGHMLAQPEVSDFFAKLIQRVAPKSYQQAVGEVYVTGKFLENFSGDQVRFLARSFGVPGNHLGQQSHGFRWPYGPVAIITPFNFPLEIPLLQLMGALYMGNKPVLKVDSKVCIVMEQMLRLLHDCGMPLDDVDFIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031365`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031365

Location Chr07:5015587-5020006 (+)

Description Similar to ALDH12A1: Delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62530`	Plays a role in the inhibition of programmed cell death by converting the toxic proline catabolism intermediate (s)-1-pyrroline-5- carboxylate (P5C) to glutamate.	A nuclear gene encoding mitochondrial Delta-pyrroline-5-carboxylate dehydrogenase and its potential role in protection from proline toxicity.2001 · DOI: 10.1046/j.1365-313x.2001.01101.x Unraveling delta1-pyrroline-5-carboxylate-proline cycle in plants by uncoupled expression of proline oxidation enzymes.2009 · DOI: 10.1074/jbc.m109.009340 P5CDH affects the pathways contributing to Pro synthesis after ProDH activation by biotic and abiotic stress conditions.2015 · DOI: 10.3389/fpls.2015.00572

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031365 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006081 aldehyde metabolic process Biological Process

GO:0006560 proline metabolic process Biological Process

GO:0009450 gamma-aminobutyric acid catabolic process Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010133 L-proline catabolic process to L-glutamate Biological Process

GO:0019568 arabinose catabolic process Biological Process

GO:0042843 D-xylose catabolic process Biological Process

GO:0048316 seed development Biological Process

GO:0072593 reactive oxygen species metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT5G62530

bsu:BSU03910

hvo:HVO_B0039

sso:SSO3117

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.904

Rank 1 · LXL04_031365 · OH-1004

Cytoplasm0.086

Rank 2 · LXL04_031365 · OH-1004

Nucleus0.045

Rank 3 · LXL04_031365 · OH-1004

Plastid0.020

Rank 4 · LXL04_031365 · OH-1004

Cell membrane0.017

Rank 5 · LXL04_031365 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00171.28Aldedh120-496 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031365	`PF00171.28`	Aldedh	120	496	1.3e-35	123.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZC3`	Arabidopsis thaliana	Delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, mitochondrial	79.091%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card